Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E1W4

Protein Details
Accession A0A178E1W4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
412-432PEKLRCWLLVNKQRNRQTRWSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019382  eIF3l  
IPR000717  PCI_dom  
Gene Ontology GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0033290  C:eukaryotic 48S preinitiation complex  
GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0016020  C:membrane  
GO:0003743  F:translation initiation factor activity  
GO:0001732  P:formation of cytoplasmic translation initiation complex  
Pfam View protein in Pfam  
PF10255  Paf67  
PROSITE View protein in PROSITE  
PS50250  PCI  
Amino Acid Sequences MSLRERVPPQYQNGDAARRAPDDESDAEDEALVNSYREQVQYDNMEELDRMPSIASNQDIHAQLQAAATPLEFQATLETKFASYDNYCNLFHYILNSEGPVDLEVPNYYWAWDVIDEFIYQFNSFCSYRQRVAQKNENGDEIQLLRENPNTWGCYSVLNVLYSLIQRSQISEQLGAMKRGEDSNAYAGEYGSRPLYKMLGYFSIIGLLRVHCLLGDFSLALKTLDDIELNKKAMFARVMAAHFTTYYYVGFSYMMMRRYADAIRMFSHILVYVSRTKNFQKNAQYDSITKKNDQMYALIAICVAFQPTRLDDTIHTALREKYGEQFNRLQRGGPDSLPLFEELFRTACPKFISPTPPDFDNPEINIDPVEHHLRIFMDEVKTNMMSPTVKSYLKLYTTMDLKKLAGFLEVEPEKLRCWLLVNKQRNRQTRWSEGGLLEGDVIHSSDLDYAMEGDLIHVSEAKVGRRLIDWYLRNLARTY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.46
4 0.43
5 0.37
6 0.38
7 0.32
8 0.29
9 0.28
10 0.28
11 0.28
12 0.28
13 0.27
14 0.24
15 0.23
16 0.21
17 0.16
18 0.17
19 0.12
20 0.09
21 0.09
22 0.12
23 0.14
24 0.15
25 0.16
26 0.15
27 0.21
28 0.24
29 0.26
30 0.25
31 0.24
32 0.23
33 0.22
34 0.21
35 0.18
36 0.14
37 0.12
38 0.1
39 0.1
40 0.12
41 0.15
42 0.16
43 0.15
44 0.16
45 0.21
46 0.22
47 0.22
48 0.21
49 0.19
50 0.17
51 0.16
52 0.16
53 0.12
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.07
61 0.12
62 0.14
63 0.16
64 0.15
65 0.16
66 0.15
67 0.16
68 0.16
69 0.15
70 0.15
71 0.17
72 0.22
73 0.26
74 0.26
75 0.27
76 0.28
77 0.25
78 0.23
79 0.22
80 0.19
81 0.17
82 0.17
83 0.16
84 0.14
85 0.14
86 0.14
87 0.11
88 0.1
89 0.08
90 0.09
91 0.09
92 0.1
93 0.11
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.1
100 0.09
101 0.09
102 0.1
103 0.1
104 0.09
105 0.1
106 0.1
107 0.1
108 0.09
109 0.08
110 0.12
111 0.12
112 0.13
113 0.2
114 0.24
115 0.26
116 0.33
117 0.41
118 0.46
119 0.54
120 0.61
121 0.6
122 0.63
123 0.62
124 0.58
125 0.49
126 0.41
127 0.35
128 0.26
129 0.2
130 0.14
131 0.14
132 0.12
133 0.14
134 0.15
135 0.16
136 0.19
137 0.19
138 0.17
139 0.19
140 0.18
141 0.17
142 0.17
143 0.18
144 0.16
145 0.15
146 0.15
147 0.13
148 0.14
149 0.13
150 0.13
151 0.09
152 0.1
153 0.1
154 0.12
155 0.14
156 0.16
157 0.17
158 0.16
159 0.16
160 0.22
161 0.24
162 0.22
163 0.21
164 0.18
165 0.17
166 0.17
167 0.17
168 0.1
169 0.1
170 0.12
171 0.12
172 0.12
173 0.11
174 0.11
175 0.11
176 0.11
177 0.1
178 0.08
179 0.08
180 0.08
181 0.09
182 0.1
183 0.09
184 0.09
185 0.1
186 0.1
187 0.11
188 0.12
189 0.11
190 0.13
191 0.12
192 0.12
193 0.11
194 0.1
195 0.09
196 0.08
197 0.08
198 0.05
199 0.06
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.06
213 0.06
214 0.1
215 0.12
216 0.13
217 0.13
218 0.13
219 0.13
220 0.14
221 0.14
222 0.11
223 0.1
224 0.12
225 0.12
226 0.12
227 0.12
228 0.1
229 0.1
230 0.1
231 0.08
232 0.06
233 0.06
234 0.06
235 0.05
236 0.06
237 0.06
238 0.06
239 0.09
240 0.11
241 0.13
242 0.13
243 0.13
244 0.13
245 0.15
246 0.15
247 0.15
248 0.14
249 0.14
250 0.15
251 0.17
252 0.16
253 0.14
254 0.14
255 0.1
256 0.09
257 0.08
258 0.09
259 0.16
260 0.17
261 0.18
262 0.21
263 0.25
264 0.3
265 0.33
266 0.38
267 0.39
268 0.42
269 0.46
270 0.47
271 0.45
272 0.42
273 0.45
274 0.45
275 0.39
276 0.35
277 0.35
278 0.34
279 0.35
280 0.33
281 0.27
282 0.21
283 0.22
284 0.21
285 0.16
286 0.13
287 0.1
288 0.09
289 0.09
290 0.08
291 0.04
292 0.05
293 0.07
294 0.08
295 0.1
296 0.11
297 0.12
298 0.12
299 0.19
300 0.22
301 0.21
302 0.21
303 0.21
304 0.21
305 0.22
306 0.23
307 0.16
308 0.18
309 0.26
310 0.28
311 0.3
312 0.37
313 0.4
314 0.46
315 0.45
316 0.41
317 0.34
318 0.38
319 0.36
320 0.29
321 0.27
322 0.21
323 0.21
324 0.2
325 0.2
326 0.15
327 0.13
328 0.13
329 0.11
330 0.11
331 0.11
332 0.13
333 0.12
334 0.14
335 0.16
336 0.17
337 0.19
338 0.23
339 0.3
340 0.31
341 0.37
342 0.37
343 0.37
344 0.38
345 0.38
346 0.36
347 0.34
348 0.3
349 0.29
350 0.26
351 0.24
352 0.22
353 0.19
354 0.17
355 0.17
356 0.2
357 0.16
358 0.15
359 0.16
360 0.17
361 0.18
362 0.19
363 0.18
364 0.17
365 0.18
366 0.19
367 0.21
368 0.2
369 0.2
370 0.18
371 0.16
372 0.14
373 0.14
374 0.2
375 0.21
376 0.22
377 0.22
378 0.25
379 0.28
380 0.29
381 0.3
382 0.26
383 0.26
384 0.32
385 0.34
386 0.34
387 0.3
388 0.29
389 0.28
390 0.27
391 0.22
392 0.17
393 0.16
394 0.13
395 0.2
396 0.2
397 0.2
398 0.21
399 0.21
400 0.2
401 0.21
402 0.21
403 0.13
404 0.17
405 0.24
406 0.33
407 0.42
408 0.52
409 0.59
410 0.68
411 0.77
412 0.8
413 0.8
414 0.8
415 0.78
416 0.77
417 0.75
418 0.7
419 0.66
420 0.57
421 0.53
422 0.43
423 0.35
424 0.26
425 0.19
426 0.15
427 0.1
428 0.1
429 0.07
430 0.06
431 0.06
432 0.07
433 0.08
434 0.07
435 0.07
436 0.08
437 0.08
438 0.08
439 0.08
440 0.07
441 0.08
442 0.08
443 0.08
444 0.08
445 0.08
446 0.12
447 0.15
448 0.18
449 0.22
450 0.22
451 0.24
452 0.25
453 0.28
454 0.29
455 0.36
456 0.36
457 0.37
458 0.46
459 0.46