Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EBS9

Protein Details
Accession A0A178EBS9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
64-83ASSLRWNPTRWNRNERFSRLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MATASPLGAACHSWLSLLVLGGRAVDSRTRCTLTSVGKSSAQARRRRNYASQNPFSSRLEELAASSLRWNPTRWNRNERFSRLYACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.07
11 0.07
12 0.11
13 0.12
14 0.15
15 0.18
16 0.2
17 0.2
18 0.23
19 0.26
20 0.27
21 0.31
22 0.31
23 0.3
24 0.29
25 0.29
26 0.32
27 0.35
28 0.37
29 0.39
30 0.43
31 0.46
32 0.49
33 0.53
34 0.54
35 0.58
36 0.61
37 0.63
38 0.62
39 0.61
40 0.6
41 0.6
42 0.54
43 0.46
44 0.36
45 0.27
46 0.22
47 0.18
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.15
54 0.17
55 0.19
56 0.2
57 0.26
58 0.37
59 0.47
60 0.53
61 0.61
62 0.64
63 0.72
64 0.8
65 0.78
66 0.74
67 0.68