Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E2T8

Protein Details
Accession A0A178E2T8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MQRRLFKQRGKKNSKKAQDPRITNIRYHydrophilic
NLS Segment(s)
PositionSequence
8-16QRGKKNSKK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MQRRLFKQRGKKNSKKAQDPRITNIRYHLSHPLTPRPLHFSRNRYLRHWTIHRAWLLFLRKRRWAEERDLERQYMSMRAACEHLRLLDQNGNRVTEEEAGGQGADPTRLGVKGREVGRLYRSAMLKRGVWGSVPIEYAKVQTDFPSRDGWNHGWVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.9
4 0.9
5 0.89
6 0.84
7 0.81
8 0.81
9 0.73
10 0.63
11 0.59
12 0.55
13 0.47
14 0.44
15 0.45
16 0.39
17 0.41
18 0.44
19 0.47
20 0.46
21 0.46
22 0.45
23 0.44
24 0.42
25 0.45
26 0.48
27 0.45
28 0.48
29 0.56
30 0.57
31 0.53
32 0.57
33 0.55
34 0.56
35 0.55
36 0.54
37 0.5
38 0.52
39 0.51
40 0.44
41 0.4
42 0.38
43 0.4
44 0.38
45 0.39
46 0.38
47 0.43
48 0.45
49 0.48
50 0.47
51 0.44
52 0.47
53 0.51
54 0.53
55 0.52
56 0.51
57 0.47
58 0.41
59 0.37
60 0.3
61 0.22
62 0.16
63 0.12
64 0.1
65 0.11
66 0.13
67 0.12
68 0.13
69 0.11
70 0.11
71 0.1
72 0.1
73 0.12
74 0.14
75 0.14
76 0.18
77 0.19
78 0.19
79 0.18
80 0.19
81 0.18
82 0.14
83 0.15
84 0.1
85 0.09
86 0.08
87 0.08
88 0.07
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.08
97 0.09
98 0.12
99 0.18
100 0.19
101 0.25
102 0.26
103 0.28
104 0.31
105 0.32
106 0.31
107 0.3
108 0.32
109 0.29
110 0.32
111 0.32
112 0.29
113 0.29
114 0.29
115 0.25
116 0.22
117 0.22
118 0.19
119 0.18
120 0.19
121 0.16
122 0.16
123 0.16
124 0.16
125 0.16
126 0.16
127 0.15
128 0.17
129 0.24
130 0.25
131 0.26
132 0.31
133 0.29
134 0.31
135 0.37
136 0.35
137 0.38