Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DUK8

Protein Details
Accession A0A178DUK8   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
263-290KLEKARLRIEEKKEKRRREHEGVVEKIRBasic
NLS Segment(s)
PositionSequence
217-235ALKKRTKARSAAQKRQHKA
254-291REKEGGDAAKLEKARLRIEEKKEKRRREHEGVVEKIRR
Subcellular Location(s) cyto 16.5, cyto_nucl 13.833, nucl 8, mito_nucl 5.499
Family & Domain DBs
Amino Acid Sequences MLQQPIAIPAASEQLGSPFLRAYPLELENLDLPAPIFLKFLDDLNRHIVVSPGLQVVNTTGDILGLAPLAEAQIVGTALNVAAEAASYGVSKSRGEMFLRQANKDLFTPRGLRVAIVRLEALALAAKIPILADDGTVRKDVSLLPPIPYDSDTNSDGDSEAQEEVSAQSRRLAALALWTSPLQIHAPLSKADLPTNKISAFHASVSEKQRIKEEEAALKKRTKARSAAQKRQHKASASLDKELERLQHEQDKLREKEGGDAAKLEKARLRIEEKKEKRRREHEGVVEKIRREVVRKDGEERAMREMGFLMVVREEEYVGLVERSVRKIRAVAATV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.15
5 0.12
6 0.12
7 0.15
8 0.15
9 0.16
10 0.18
11 0.2
12 0.21
13 0.21
14 0.23
15 0.21
16 0.22
17 0.19
18 0.13
19 0.12
20 0.11
21 0.12
22 0.1
23 0.09
24 0.08
25 0.11
26 0.12
27 0.14
28 0.2
29 0.21
30 0.24
31 0.28
32 0.29
33 0.26
34 0.26
35 0.24
36 0.18
37 0.17
38 0.17
39 0.13
40 0.12
41 0.12
42 0.12
43 0.12
44 0.13
45 0.12
46 0.1
47 0.08
48 0.08
49 0.08
50 0.08
51 0.07
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.06
77 0.07
78 0.07
79 0.09
80 0.12
81 0.15
82 0.18
83 0.22
84 0.26
85 0.32
86 0.35
87 0.35
88 0.35
89 0.33
90 0.32
91 0.3
92 0.27
93 0.22
94 0.23
95 0.25
96 0.22
97 0.25
98 0.23
99 0.22
100 0.21
101 0.23
102 0.21
103 0.18
104 0.17
105 0.12
106 0.12
107 0.12
108 0.1
109 0.06
110 0.04
111 0.04
112 0.04
113 0.04
114 0.03
115 0.03
116 0.03
117 0.04
118 0.04
119 0.05
120 0.07
121 0.08
122 0.09
123 0.1
124 0.09
125 0.08
126 0.09
127 0.09
128 0.11
129 0.16
130 0.16
131 0.16
132 0.17
133 0.17
134 0.18
135 0.18
136 0.16
137 0.11
138 0.14
139 0.13
140 0.14
141 0.13
142 0.12
143 0.11
144 0.11
145 0.09
146 0.07
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.1
153 0.1
154 0.09
155 0.11
156 0.12
157 0.12
158 0.12
159 0.11
160 0.06
161 0.1
162 0.1
163 0.09
164 0.09
165 0.09
166 0.09
167 0.09
168 0.1
169 0.07
170 0.07
171 0.07
172 0.08
173 0.09
174 0.09
175 0.12
176 0.13
177 0.14
178 0.16
179 0.17
180 0.2
181 0.21
182 0.22
183 0.2
184 0.19
185 0.19
186 0.2
187 0.18
188 0.15
189 0.16
190 0.16
191 0.22
192 0.25
193 0.31
194 0.3
195 0.29
196 0.34
197 0.33
198 0.36
199 0.36
200 0.36
201 0.37
202 0.43
203 0.47
204 0.46
205 0.47
206 0.47
207 0.48
208 0.5
209 0.46
210 0.45
211 0.48
212 0.56
213 0.63
214 0.69
215 0.71
216 0.76
217 0.75
218 0.76
219 0.72
220 0.63
221 0.59
222 0.58
223 0.58
224 0.51
225 0.51
226 0.45
227 0.41
228 0.4
229 0.35
230 0.29
231 0.22
232 0.21
233 0.22
234 0.27
235 0.29
236 0.33
237 0.38
238 0.45
239 0.44
240 0.44
241 0.43
242 0.37
243 0.41
244 0.41
245 0.37
246 0.28
247 0.28
248 0.27
249 0.28
250 0.28
251 0.23
252 0.2
253 0.21
254 0.24
255 0.27
256 0.34
257 0.38
258 0.48
259 0.57
260 0.64
261 0.72
262 0.79
263 0.83
264 0.86
265 0.86
266 0.87
267 0.85
268 0.84
269 0.83
270 0.83
271 0.8
272 0.79
273 0.75
274 0.66
275 0.59
276 0.55
277 0.47
278 0.42
279 0.4
280 0.41
281 0.46
282 0.48
283 0.51
284 0.52
285 0.57
286 0.58
287 0.55
288 0.51
289 0.44
290 0.41
291 0.36
292 0.3
293 0.23
294 0.18
295 0.16
296 0.11
297 0.1
298 0.1
299 0.1
300 0.1
301 0.1
302 0.08
303 0.09
304 0.09
305 0.09
306 0.09
307 0.09
308 0.13
309 0.17
310 0.23
311 0.28
312 0.28
313 0.3
314 0.32
315 0.37