Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DZD7

Protein Details
Accession A0A178DZD7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-48SRSHHTRRRARDGRPRREIRBasic
NLS Segment(s)
PositionSequence
35-45RRRARDGRPRR
Subcellular Location(s) mito 8cyto 8cyto_mito 8, nucl 4, pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCTNCRGIVDGKEEVIQGWPQLAVAFASSRSHHTRRRARDGRPRREIRDFSLLFPYFTLGVVQSSVALVPPVHARIHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.11
5 0.1
6 0.09
7 0.08
8 0.08
9 0.08
10 0.05
11 0.06
12 0.06
13 0.06
14 0.08
15 0.09
16 0.13
17 0.19
18 0.25
19 0.3
20 0.4
21 0.48
22 0.54
23 0.64
24 0.67
25 0.69
26 0.75
27 0.79
28 0.8
29 0.81
30 0.79
31 0.73
32 0.75
33 0.69
34 0.63
35 0.62
36 0.53
37 0.45
38 0.47
39 0.42
40 0.34
41 0.31
42 0.27
43 0.18
44 0.17
45 0.15
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.1
58 0.13