Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DWV6

Protein Details
Accession A0A178DWV6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
256-283DENPEEKPIERRPRKRAPGDPRRSYFGSBasic
NLS Segment(s)
PositionSequence
264-276IERRPRKRAPGDP
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences MRPKRNTRGHSVKATPQKDAQTSSKSASSKHRGAQQRDPKKPPALPPTPEPSSNSASASATPEAPEVLEHESEVTGHPEKPTLLVNCKNESVKLNIQLPLRHVFTFPFLGVQSMVGEAFKMGIEKAEKRKAERTMQEAMQEYAVIHHRACSENNLQQSYRHEGTAMLDEPEDHRCTDEFEDGMGPHRKTVRFTVYDETMPTQTDLDTNTHQRLRSGIDTRLPTPNSQSPTPRPRPHHSGMSDSAGTIRDVVMHDVDENPEEKPIERRPRKRAPGDPRRSYFGSAYDLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.66
3 0.61
4 0.6
5 0.54
6 0.54
7 0.51
8 0.47
9 0.48
10 0.46
11 0.47
12 0.41
13 0.42
14 0.46
15 0.48
16 0.48
17 0.5
18 0.56
19 0.59
20 0.65
21 0.72
22 0.73
23 0.75
24 0.79
25 0.8
26 0.78
27 0.77
28 0.75
29 0.73
30 0.73
31 0.7
32 0.64
33 0.64
34 0.64
35 0.6
36 0.56
37 0.5
38 0.45
39 0.41
40 0.39
41 0.34
42 0.27
43 0.24
44 0.23
45 0.24
46 0.2
47 0.16
48 0.15
49 0.14
50 0.13
51 0.12
52 0.11
53 0.09
54 0.11
55 0.1
56 0.09
57 0.1
58 0.1
59 0.1
60 0.11
61 0.12
62 0.12
63 0.13
64 0.13
65 0.14
66 0.14
67 0.15
68 0.19
69 0.19
70 0.24
71 0.3
72 0.33
73 0.35
74 0.38
75 0.37
76 0.34
77 0.32
78 0.31
79 0.29
80 0.3
81 0.3
82 0.31
83 0.33
84 0.32
85 0.33
86 0.31
87 0.29
88 0.25
89 0.22
90 0.19
91 0.19
92 0.19
93 0.16
94 0.13
95 0.11
96 0.11
97 0.1
98 0.1
99 0.08
100 0.06
101 0.06
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.03
109 0.05
110 0.08
111 0.13
112 0.19
113 0.26
114 0.28
115 0.31
116 0.37
117 0.41
118 0.46
119 0.45
120 0.43
121 0.41
122 0.41
123 0.4
124 0.35
125 0.3
126 0.22
127 0.18
128 0.14
129 0.11
130 0.12
131 0.1
132 0.08
133 0.1
134 0.11
135 0.12
136 0.13
137 0.16
138 0.18
139 0.21
140 0.24
141 0.25
142 0.24
143 0.24
144 0.27
145 0.29
146 0.26
147 0.22
148 0.19
149 0.18
150 0.19
151 0.2
152 0.17
153 0.11
154 0.1
155 0.1
156 0.12
157 0.14
158 0.14
159 0.11
160 0.11
161 0.11
162 0.13
163 0.15
164 0.15
165 0.12
166 0.12
167 0.13
168 0.12
169 0.17
170 0.2
171 0.18
172 0.19
173 0.24
174 0.24
175 0.26
176 0.31
177 0.32
178 0.3
179 0.33
180 0.35
181 0.33
182 0.33
183 0.32
184 0.29
185 0.23
186 0.2
187 0.18
188 0.13
189 0.11
190 0.11
191 0.11
192 0.12
193 0.15
194 0.19
195 0.23
196 0.26
197 0.26
198 0.25
199 0.25
200 0.27
201 0.3
202 0.31
203 0.29
204 0.33
205 0.35
206 0.38
207 0.43
208 0.4
209 0.34
210 0.36
211 0.38
212 0.37
213 0.38
214 0.42
215 0.44
216 0.53
217 0.62
218 0.64
219 0.66
220 0.69
221 0.74
222 0.73
223 0.73
224 0.66
225 0.63
226 0.58
227 0.55
228 0.47
229 0.39
230 0.34
231 0.26
232 0.23
233 0.16
234 0.13
235 0.09
236 0.1
237 0.12
238 0.12
239 0.11
240 0.12
241 0.13
242 0.14
243 0.14
244 0.14
245 0.12
246 0.14
247 0.14
248 0.15
249 0.21
250 0.29
251 0.39
252 0.49
253 0.58
254 0.66
255 0.76
256 0.85
257 0.88
258 0.88
259 0.88
260 0.89
261 0.91
262 0.91
263 0.85
264 0.81
265 0.75
266 0.68
267 0.59
268 0.52