Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DPN0

Protein Details
Accession A0A178DPN0    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
355-384ESKVTVHNGRRRGRRRVMKRQKVKDEEGYLBasic
NLS Segment(s)
PositionSequence
363-376GRRRGRRRVMKRQK
403-426KKLKSTPIPKVAGPGKGKTNGKKG
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MADDSHGSYLAARILTESQPVTYRLLSRALKVNVNTAKLMLFDFHQSQNAKQSKSVHATYLLTGNRRSPTQPKGLDRDGEDLVMRSSPFMSSMMDPEEVSEAPVPKMTIVLAREEEVERVRATFEDEVTIHIYSLEPGPLENLHALCACNLEVAMTYASEDPMERWRTYGDIQNPYIKRRTAKYAPSGVNHKLDAGANATAKSNMNLKGSKEPLQNPGDNVSGRSASSPSVSATMLKRSDSKPGNKNDNTAGSIFKSFAKAKSKAREVEQPQASALKPSGDKVMQGMSEDEGEEDDKPEIVIDDLKNEAARKAREERTERLHEEMLDAPTLTESQPAPSPPTTAKLASPEPSESESKVTVHNGRRRGRRRVMKRQKVKDEEGYLVTREEAVWESFSEDEPEPKKLKSTPIPKVAGPGKGKTNGKKGQGSIASFFKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.2
4 0.19
5 0.18
6 0.21
7 0.23
8 0.23
9 0.23
10 0.25
11 0.24
12 0.32
13 0.31
14 0.33
15 0.4
16 0.4
17 0.43
18 0.41
19 0.48
20 0.45
21 0.46
22 0.42
23 0.34
24 0.31
25 0.26
26 0.25
27 0.17
28 0.13
29 0.16
30 0.19
31 0.2
32 0.25
33 0.26
34 0.28
35 0.37
36 0.41
37 0.38
38 0.39
39 0.43
40 0.45
41 0.5
42 0.5
43 0.42
44 0.4
45 0.4
46 0.37
47 0.38
48 0.34
49 0.3
50 0.3
51 0.32
52 0.31
53 0.32
54 0.35
55 0.35
56 0.38
57 0.45
58 0.51
59 0.53
60 0.58
61 0.6
62 0.6
63 0.55
64 0.52
65 0.43
66 0.37
67 0.3
68 0.23
69 0.19
70 0.17
71 0.14
72 0.1
73 0.1
74 0.09
75 0.1
76 0.1
77 0.11
78 0.11
79 0.13
80 0.15
81 0.15
82 0.15
83 0.14
84 0.16
85 0.13
86 0.14
87 0.14
88 0.13
89 0.13
90 0.14
91 0.13
92 0.11
93 0.12
94 0.11
95 0.12
96 0.11
97 0.14
98 0.14
99 0.15
100 0.17
101 0.17
102 0.18
103 0.16
104 0.17
105 0.14
106 0.13
107 0.13
108 0.11
109 0.14
110 0.14
111 0.13
112 0.14
113 0.13
114 0.15
115 0.16
116 0.16
117 0.12
118 0.11
119 0.11
120 0.09
121 0.1
122 0.08
123 0.06
124 0.06
125 0.07
126 0.07
127 0.08
128 0.09
129 0.09
130 0.09
131 0.1
132 0.1
133 0.09
134 0.1
135 0.09
136 0.07
137 0.07
138 0.06
139 0.05
140 0.06
141 0.06
142 0.05
143 0.06
144 0.06
145 0.07
146 0.07
147 0.07
148 0.07
149 0.13
150 0.17
151 0.16
152 0.16
153 0.17
154 0.19
155 0.21
156 0.26
157 0.26
158 0.28
159 0.3
160 0.37
161 0.38
162 0.39
163 0.41
164 0.37
165 0.34
166 0.31
167 0.38
168 0.37
169 0.41
170 0.45
171 0.49
172 0.5
173 0.5
174 0.52
175 0.47
176 0.43
177 0.36
178 0.3
179 0.22
180 0.2
181 0.17
182 0.14
183 0.12
184 0.1
185 0.11
186 0.11
187 0.11
188 0.11
189 0.11
190 0.13
191 0.14
192 0.16
193 0.18
194 0.19
195 0.24
196 0.27
197 0.31
198 0.32
199 0.31
200 0.35
201 0.37
202 0.36
203 0.31
204 0.3
205 0.27
206 0.23
207 0.21
208 0.16
209 0.12
210 0.11
211 0.11
212 0.1
213 0.08
214 0.09
215 0.08
216 0.08
217 0.09
218 0.09
219 0.1
220 0.11
221 0.15
222 0.15
223 0.16
224 0.19
225 0.18
226 0.27
227 0.3
228 0.37
229 0.4
230 0.47
231 0.55
232 0.53
233 0.54
234 0.49
235 0.46
236 0.4
237 0.33
238 0.27
239 0.18
240 0.18
241 0.16
242 0.14
243 0.15
244 0.15
245 0.2
246 0.26
247 0.29
248 0.36
249 0.43
250 0.48
251 0.48
252 0.5
253 0.54
254 0.51
255 0.56
256 0.51
257 0.44
258 0.38
259 0.37
260 0.34
261 0.26
262 0.22
263 0.15
264 0.13
265 0.13
266 0.17
267 0.14
268 0.14
269 0.14
270 0.16
271 0.13
272 0.13
273 0.13
274 0.1
275 0.1
276 0.1
277 0.09
278 0.07
279 0.08
280 0.07
281 0.08
282 0.07
283 0.07
284 0.07
285 0.07
286 0.06
287 0.06
288 0.1
289 0.09
290 0.1
291 0.11
292 0.12
293 0.13
294 0.13
295 0.15
296 0.17
297 0.18
298 0.22
299 0.29
300 0.35
301 0.42
302 0.47
303 0.5
304 0.53
305 0.6
306 0.56
307 0.53
308 0.48
309 0.4
310 0.37
311 0.35
312 0.28
313 0.2
314 0.18
315 0.14
316 0.13
317 0.13
318 0.11
319 0.1
320 0.09
321 0.1
322 0.13
323 0.14
324 0.18
325 0.18
326 0.21
327 0.2
328 0.23
329 0.24
330 0.23
331 0.24
332 0.24
333 0.27
334 0.28
335 0.29
336 0.27
337 0.26
338 0.29
339 0.29
340 0.25
341 0.25
342 0.23
343 0.22
344 0.22
345 0.25
346 0.29
347 0.37
348 0.42
349 0.48
350 0.55
351 0.65
352 0.71
353 0.76
354 0.79
355 0.81
356 0.85
357 0.87
358 0.9
359 0.91
360 0.93
361 0.93
362 0.94
363 0.91
364 0.87
365 0.84
366 0.78
367 0.7
368 0.64
369 0.56
370 0.46
371 0.38
372 0.31
373 0.23
374 0.18
375 0.15
376 0.13
377 0.12
378 0.12
379 0.12
380 0.14
381 0.14
382 0.15
383 0.17
384 0.16
385 0.22
386 0.23
387 0.29
388 0.3
389 0.3
390 0.34
391 0.34
392 0.43
393 0.46
394 0.53
395 0.57
396 0.64
397 0.67
398 0.62
399 0.67
400 0.63
401 0.62
402 0.56
403 0.52
404 0.49
405 0.54
406 0.61
407 0.6
408 0.65
409 0.64
410 0.67
411 0.69
412 0.64
413 0.65
414 0.64
415 0.6
416 0.55
417 0.56