FuNGI

A0A178DPX6

Protein Details

Accession

A0A178DPX6

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
352-378	TDITYFMKHTDKRKNKRRAPTALSFAA	Hydrophilic

NLS Segment(s)

Position	Sequence
363-390	KRKNKRRAPTALSFAATSKRSGAKVRKI

Subcellular Location(s)

cyto_nucl 12.5, cyto 11, nucl 10, extr 5

Family & Domain DBs

InterPro	View protein in InterPro IPR041664 AAA_16 IPR020796 ORC5 IPR047088 ORC5_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0005634 C:nucleus GO:0000808 C:origin recognition complex GO:0006260 P:DNA replication
Pfam	View protein in Pfam PF13191 AAA_16 PF14630 ORC5_C

Amino Acid Sequences

MLPDEIITQLNAEFQCRDQQVQQLAALYSAHLPSPTFLNIHGLAATGKTSILRSFFRLSGISNLYINVRECITARHLLERIVAGSLDALEEFYDEKIDKRPYARTENLSALCVNLSKMLEGREKFVLVLDAIDKLREGGGATLIPALARLGETIPNLSLILTTTLLLGPSSLHSTSTCYLSFPPYPRSDLLSIAGANPPKIFLTPPSLEKFPDYTPDLAAEDDAWLWNRFLAAVYDSLSKHTGRDLISFKACALKIWREFVAPVVSGAFGTRDFSRLMVNRRHLFQLEDSVLDRIISAPSTTQSTSTTAPGALEPQTPSKKTLAKMTVHDLPFYTTHLLIAAYLASYNPPRTDITYFMKHTDKRKNKRRAPTALSFAATSKRSGAKVRKIPRHLLTPSPFALDRLLAIFRALLTENVGQGADLYTQIATLTSLRLLVRAGAGAGDA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.17
2	0.25
3	0.26
4	0.3
5	0.28
6	0.35
7	0.37
8	0.38
9	0.38
10	0.33
11	0.31
12	0.28
13	0.25
14	0.19
15	0.16
16	0.14
17	0.14
18	0.11
19	0.11
20	0.12
21	0.15
22	0.16
23	0.14
24	0.14
25	0.19
26	0.19
27	0.19
28	0.18
29	0.15
30	0.14
31	0.14
32	0.14
33	0.09
34	0.08
35	0.08
36	0.1
37	0.12
38	0.15
39	0.17
40	0.21
41	0.25
42	0.26
43	0.27
44	0.26
45	0.26
46	0.28
47	0.3
48	0.26
49	0.23
50	0.23
51	0.22
52	0.24
53	0.23
54	0.18
55	0.15
56	0.14
57	0.14
58	0.17
59	0.2
60	0.23
61	0.23
62	0.28
63	0.28
64	0.28
65	0.29
66	0.27
67	0.23
68	0.18
69	0.16
70	0.11
71	0.1
72	0.09
73	0.07
74	0.06
75	0.05
76	0.04
77	0.05
78	0.06
79	0.06
80	0.07
81	0.07
82	0.09
83	0.16
84	0.2
85	0.23
86	0.25
87	0.32
88	0.37
89	0.46
90	0.5
91	0.48
92	0.49
93	0.52
94	0.5
95	0.44
96	0.38
97	0.3
98	0.24
99	0.2
100	0.16
101	0.12
102	0.11
103	0.1
104	0.11
105	0.14
106	0.2
107	0.2
108	0.23
109	0.22
110	0.22
111	0.21
112	0.21
113	0.18
114	0.11
115	0.12
116	0.09
117	0.1
118	0.1
119	0.1
120	0.09
121	0.08
122	0.08
123	0.08
124	0.07
125	0.05
126	0.06
127	0.06
128	0.07
129	0.07
130	0.06
131	0.06
132	0.06
133	0.05
134	0.04
135	0.04
136	0.04
137	0.05
138	0.07
139	0.07
140	0.08
141	0.08
142	0.09
143	0.09
144	0.08
145	0.07
146	0.06
147	0.07
148	0.06
149	0.06
150	0.06
151	0.06
152	0.07
153	0.06
154	0.06
155	0.05
156	0.05
157	0.08
158	0.08
159	0.08
160	0.08
161	0.12
162	0.13
163	0.15
164	0.14
165	0.12
166	0.13
167	0.16
168	0.2
169	0.2
170	0.24
171	0.23
172	0.26
173	0.26
174	0.29
175	0.26
176	0.24
177	0.22
178	0.18
179	0.16
180	0.14
181	0.16
182	0.13
183	0.12
184	0.1
185	0.1
186	0.08
187	0.09
188	0.08
189	0.08
190	0.14
191	0.15
192	0.19
193	0.22
194	0.22
195	0.22
196	0.23
197	0.24
198	0.17
199	0.2
200	0.18
201	0.16
202	0.15
203	0.16
204	0.15
205	0.12
206	0.12
207	0.08
208	0.06
209	0.06
210	0.06
211	0.06
212	0.06
213	0.06
214	0.06
215	0.06
216	0.06
217	0.06
218	0.06
219	0.06
220	0.06
221	0.07
222	0.1
223	0.1
224	0.11
225	0.12
226	0.12
227	0.11
228	0.12
229	0.14
230	0.12
231	0.17
232	0.18
233	0.2
234	0.21
235	0.21
236	0.2
237	0.22
238	0.2
239	0.17
240	0.19
241	0.22
242	0.23
243	0.25
244	0.26
245	0.21
246	0.21
247	0.22
248	0.2
249	0.14
250	0.12
251	0.09
252	0.09
253	0.08
254	0.08
255	0.07
256	0.05
257	0.07
258	0.07
259	0.08
260	0.08
261	0.09
262	0.13
263	0.17
264	0.23
265	0.28
266	0.35
267	0.36
268	0.38
269	0.4
270	0.36
271	0.34
272	0.29
273	0.28
274	0.22
275	0.21
276	0.19
277	0.18
278	0.17
279	0.15
280	0.13
281	0.08
282	0.07
283	0.06
284	0.06
285	0.06
286	0.07
287	0.1
288	0.1
289	0.11
290	0.12
291	0.14
292	0.15
293	0.16
294	0.15
295	0.13
296	0.13
297	0.12
298	0.13
299	0.12
300	0.13
301	0.13
302	0.2
303	0.24
304	0.25
305	0.27
306	0.3
307	0.33
308	0.33
309	0.4
310	0.4
311	0.39
312	0.42
313	0.45
314	0.48
315	0.43
316	0.42
317	0.34
318	0.29
319	0.26
320	0.25
321	0.21
322	0.13
323	0.13
324	0.13
325	0.12
326	0.1
327	0.09
328	0.07
329	0.05
330	0.05
331	0.05
332	0.07
333	0.09
334	0.11
335	0.11
336	0.13
337	0.15
338	0.18
339	0.21
340	0.24
341	0.29
342	0.34
343	0.36
344	0.38
345	0.44
346	0.45
347	0.51
348	0.57
349	0.61
350	0.65
351	0.74
352	0.81
353	0.83
354	0.89
355	0.9
356	0.89
357	0.87
358	0.84
359	0.81
360	0.74
361	0.65
362	0.55
363	0.47
364	0.42
365	0.35
366	0.27
367	0.24
368	0.24
369	0.26
370	0.34
371	0.42
372	0.46
373	0.55
374	0.65
375	0.71
376	0.73
377	0.79
378	0.76
379	0.76
380	0.69
381	0.69
382	0.64
383	0.6
384	0.54
385	0.5
386	0.44
387	0.36
388	0.34
389	0.25
390	0.2
391	0.17
392	0.17
393	0.13
394	0.13
395	0.12
396	0.1
397	0.12
398	0.12
399	0.1
400	0.13
401	0.14
402	0.14
403	0.15
404	0.15
405	0.12
406	0.12
407	0.13
408	0.09
409	0.08
410	0.08
411	0.07
412	0.08
413	0.08
414	0.07
415	0.07
416	0.08
417	0.09
418	0.09
419	0.12
420	0.12
421	0.12
422	0.13
423	0.13
424	0.13
425	0.12
426	0.12

A0A178DPX6

3D AlphaFold-predicted Structure Viewer