Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DPX6

Protein Details
Accession A0A178DPX6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
352-378TDITYFMKHTDKRKNKRRAPTALSFAAHydrophilic
NLS Segment(s)
PositionSequence
363-390KRKNKRRAPTALSFAATSKRSGAKVRKI
Subcellular Location(s) cyto_nucl 12.5, cyto 11, nucl 10, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041664  AAA_16  
IPR020796  ORC5  
IPR047088  ORC5_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005634  C:nucleus  
GO:0000808  C:origin recognition complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF13191  AAA_16  
PF14630  ORC5_C  
Amino Acid Sequences MLPDEIITQLNAEFQCRDQQVQQLAALYSAHLPSPTFLNIHGLAATGKTSILRSFFRLSGISNLYINVRECITARHLLERIVAGSLDALEEFYDEKIDKRPYARTENLSALCVNLSKMLEGREKFVLVLDAIDKLREGGGATLIPALARLGETIPNLSLILTTTLLLGPSSLHSTSTCYLSFPPYPRSDLLSIAGANPPKIFLTPPSLEKFPDYTPDLAAEDDAWLWNRFLAAVYDSLSKHTGRDLISFKACALKIWREFVAPVVSGAFGTRDFSRLMVNRRHLFQLEDSVLDRIISAPSTTQSTSTTAPGALEPQTPSKKTLAKMTVHDLPFYTTHLLIAAYLASYNPPRTDITYFMKHTDKRKNKRRAPTALSFAATSKRSGAKVRKIPRHLLTPSPFALDRLLAIFRALLTENVGQGADLYTQIATLTSLRLLVRAGAGAGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.26
4 0.3
5 0.28
6 0.35
7 0.37
8 0.38
9 0.38
10 0.33
11 0.31
12 0.28
13 0.25
14 0.19
15 0.16
16 0.14
17 0.14
18 0.11
19 0.11
20 0.12
21 0.15
22 0.16
23 0.14
24 0.14
25 0.19
26 0.19
27 0.19
28 0.18
29 0.15
30 0.14
31 0.14
32 0.14
33 0.09
34 0.08
35 0.08
36 0.1
37 0.12
38 0.15
39 0.17
40 0.21
41 0.25
42 0.26
43 0.27
44 0.26
45 0.26
46 0.28
47 0.3
48 0.26
49 0.23
50 0.23
51 0.22
52 0.24
53 0.23
54 0.18
55 0.15
56 0.14
57 0.14
58 0.17
59 0.2
60 0.23
61 0.23
62 0.28
63 0.28
64 0.28
65 0.29
66 0.27
67 0.23
68 0.18
69 0.16
70 0.11
71 0.1
72 0.09
73 0.07
74 0.06
75 0.05
76 0.04
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.09
83 0.16
84 0.2
85 0.23
86 0.25
87 0.32
88 0.37
89 0.46
90 0.5
91 0.48
92 0.49
93 0.52
94 0.5
95 0.44
96 0.38
97 0.3
98 0.24
99 0.2
100 0.16
101 0.12
102 0.11
103 0.1
104 0.11
105 0.14
106 0.2
107 0.2
108 0.23
109 0.22
110 0.22
111 0.21
112 0.21
113 0.18
114 0.11
115 0.12
116 0.09
117 0.1
118 0.1
119 0.1
120 0.09
121 0.08
122 0.08
123 0.08
124 0.07
125 0.05
126 0.06
127 0.06
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.05
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.09
144 0.08
145 0.07
146 0.06
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07
153 0.06
154 0.06
155 0.05
156 0.05
157 0.08
158 0.08
159 0.08
160 0.08
161 0.12
162 0.13
163 0.15
164 0.14
165 0.12
166 0.13
167 0.16
168 0.2
169 0.2
170 0.24
171 0.23
172 0.26
173 0.26
174 0.29
175 0.26
176 0.24
177 0.22
178 0.18
179 0.16
180 0.14
181 0.16
182 0.13
183 0.12
184 0.1
185 0.1
186 0.08
187 0.09
188 0.08
189 0.08
190 0.14
191 0.15
192 0.19
193 0.22
194 0.22
195 0.22
196 0.23
197 0.24
198 0.17
199 0.2
200 0.18
201 0.16
202 0.15
203 0.16
204 0.15
205 0.12
206 0.12
207 0.08
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.07
222 0.1
223 0.1
224 0.11
225 0.12
226 0.12
227 0.11
228 0.12
229 0.14
230 0.12
231 0.17
232 0.18
233 0.2
234 0.21
235 0.21
236 0.2
237 0.22
238 0.2
239 0.17
240 0.19
241 0.22
242 0.23
243 0.25
244 0.26
245 0.21
246 0.21
247 0.22
248 0.2
249 0.14
250 0.12
251 0.09
252 0.09
253 0.08
254 0.08
255 0.07
256 0.05
257 0.07
258 0.07
259 0.08
260 0.08
261 0.09
262 0.13
263 0.17
264 0.23
265 0.28
266 0.35
267 0.36
268 0.38
269 0.4
270 0.36
271 0.34
272 0.29
273 0.28
274 0.22
275 0.21
276 0.19
277 0.18
278 0.17
279 0.15
280 0.13
281 0.08
282 0.07
283 0.06
284 0.06
285 0.06
286 0.07
287 0.1
288 0.1
289 0.11
290 0.12
291 0.14
292 0.15
293 0.16
294 0.15
295 0.13
296 0.13
297 0.12
298 0.13
299 0.12
300 0.13
301 0.13
302 0.2
303 0.24
304 0.25
305 0.27
306 0.3
307 0.33
308 0.33
309 0.4
310 0.4
311 0.39
312 0.42
313 0.45
314 0.48
315 0.43
316 0.42
317 0.34
318 0.29
319 0.26
320 0.25
321 0.21
322 0.13
323 0.13
324 0.13
325 0.12
326 0.1
327 0.09
328 0.07
329 0.05
330 0.05
331 0.05
332 0.07
333 0.09
334 0.11
335 0.11
336 0.13
337 0.15
338 0.18
339 0.21
340 0.24
341 0.29
342 0.34
343 0.36
344 0.38
345 0.44
346 0.45
347 0.51
348 0.57
349 0.61
350 0.65
351 0.74
352 0.81
353 0.83
354 0.89
355 0.9
356 0.89
357 0.87
358 0.84
359 0.81
360 0.74
361 0.65
362 0.55
363 0.47
364 0.42
365 0.35
366 0.27
367 0.24
368 0.24
369 0.26
370 0.34
371 0.42
372 0.46
373 0.55
374 0.65
375 0.71
376 0.73
377 0.79
378 0.76
379 0.76
380 0.69
381 0.69
382 0.64
383 0.6
384 0.54
385 0.5
386 0.44
387 0.36
388 0.34
389 0.25
390 0.2
391 0.17
392 0.17
393 0.13
394 0.13
395 0.12
396 0.1
397 0.12
398 0.12
399 0.1
400 0.13
401 0.14
402 0.14
403 0.15
404 0.15
405 0.12
406 0.12
407 0.13
408 0.09
409 0.08
410 0.08
411 0.07
412 0.08
413 0.08
414 0.07
415 0.07
416 0.08
417 0.09
418 0.09
419 0.12
420 0.12
421 0.12
422 0.13
423 0.13
424 0.13
425 0.12
426 0.12