Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DLV9

Protein Details
Accession A0A178DLV9   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKVPWRLSRHQKYRQRERLRHVDTIHydrophilic
77-103KYTVFDRKVKRYRKGIHKVPKWTRVSQHydrophilic
NLS Segment(s)
PositionSequence
85-94VKRYRKGIHK
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRLTNPLSGGLLWKVPWRLSRHQKYRQRERLRHVDTIVSTLDTALRRLGQSMKKVERWKVEMPTEGEMLPRDKYTVFDRKVKRYRKGIHKVPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.17
5 0.17
6 0.19
7 0.25
8 0.29
9 0.38
10 0.48
11 0.58
12 0.64
13 0.72
14 0.79
15 0.84
16 0.88
17 0.89
18 0.89
19 0.86
20 0.84
21 0.85
22 0.81
23 0.74
24 0.64
25 0.57
26 0.46
27 0.4
28 0.32
29 0.21
30 0.16
31 0.12
32 0.14
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.1
39 0.15
40 0.17
41 0.21
42 0.27
43 0.31
44 0.36
45 0.4
46 0.43
47 0.42
48 0.44
49 0.44
50 0.42
51 0.41
52 0.39
53 0.37
54 0.34
55 0.31
56 0.25
57 0.22
58 0.18
59 0.17
60 0.14
61 0.12
62 0.11
63 0.1
64 0.13
65 0.19
66 0.27
67 0.29
68 0.37
69 0.43
70 0.53
71 0.62
72 0.69
73 0.71
74 0.71
75 0.77
76 0.8
77 0.84
78 0.84
79 0.85
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.8
86 0.8
87 0.79
88 0.8
89 0.77
90 0.79