Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EJ89

Protein Details
Accession A0A178EJ89    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
165-195LTTLEEPSRKRTRKNKKTRIAIRKKHEAIKSHydrophilic
206-239ERDEAEREKRTRRNREKKVKRKAKEKAKKAVDGTBasic
NLS Segment(s)
PositionSequence
172-234SRKRTRKNKKTRIAIRKKHEAIKSRQEEKAKLALERDEAEREKRTRRNREKKVKRKAKEKAKK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MADLTGAKWVRRNELESPASSARSSPDPDIEELLRSRLSQQYTFTATAHDSVGENGAKSDEDEIELRLFATTSNTAPQANKIRLSSPGVQAGEGGFRVKKPRSYYFADKPSQAAQADLLAAAIEGKTIIELSQQPWPGCALPWKVQKISPTGMSKQILVGHPPTLTTLEEPSRKRTRKNKKTRIAIRKKHEAIKSRQEEKAKLALERDEAEREKRTRRNREKKVKRKAKEKAKKAVDGTAQDTAALSEAEQDDEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.45
4 0.49
5 0.43
6 0.41
7 0.36
8 0.32
9 0.26
10 0.26
11 0.28
12 0.24
13 0.26
14 0.27
15 0.29
16 0.32
17 0.29
18 0.28
19 0.25
20 0.25
21 0.21
22 0.19
23 0.2
24 0.22
25 0.25
26 0.24
27 0.26
28 0.28
29 0.32
30 0.33
31 0.3
32 0.27
33 0.24
34 0.23
35 0.2
36 0.16
37 0.12
38 0.11
39 0.14
40 0.13
41 0.12
42 0.11
43 0.11
44 0.1
45 0.1
46 0.12
47 0.08
48 0.1
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.09
55 0.09
56 0.07
57 0.09
58 0.09
59 0.09
60 0.12
61 0.12
62 0.14
63 0.14
64 0.21
65 0.25
66 0.27
67 0.29
68 0.28
69 0.28
70 0.3
71 0.35
72 0.32
73 0.27
74 0.3
75 0.27
76 0.26
77 0.25
78 0.22
79 0.18
80 0.14
81 0.13
82 0.07
83 0.08
84 0.14
85 0.16
86 0.2
87 0.25
88 0.31
89 0.35
90 0.42
91 0.49
92 0.52
93 0.57
94 0.55
95 0.49
96 0.45
97 0.42
98 0.38
99 0.3
100 0.22
101 0.14
102 0.12
103 0.12
104 0.09
105 0.07
106 0.04
107 0.04
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.04
117 0.05
118 0.07
119 0.11
120 0.13
121 0.13
122 0.14
123 0.15
124 0.14
125 0.13
126 0.16
127 0.16
128 0.2
129 0.26
130 0.29
131 0.29
132 0.31
133 0.33
134 0.32
135 0.31
136 0.3
137 0.28
138 0.27
139 0.31
140 0.3
141 0.28
142 0.25
143 0.27
144 0.22
145 0.2
146 0.19
147 0.15
148 0.15
149 0.15
150 0.14
151 0.12
152 0.12
153 0.1
154 0.12
155 0.16
156 0.22
157 0.24
158 0.31
159 0.4
160 0.43
161 0.51
162 0.58
163 0.65
164 0.7
165 0.8
166 0.83
167 0.83
168 0.91
169 0.92
170 0.93
171 0.93
172 0.91
173 0.88
174 0.88
175 0.83
176 0.8
177 0.76
178 0.74
179 0.71
180 0.72
181 0.73
182 0.68
183 0.68
184 0.65
185 0.61
186 0.57
187 0.56
188 0.47
189 0.4
190 0.37
191 0.34
192 0.32
193 0.31
194 0.29
195 0.28
196 0.28
197 0.3
198 0.35
199 0.37
200 0.44
201 0.5
202 0.58
203 0.64
204 0.73
205 0.8
206 0.84
207 0.91
208 0.93
209 0.95
210 0.96
211 0.95
212 0.93
213 0.93
214 0.92
215 0.92
216 0.92
217 0.91
218 0.9
219 0.88
220 0.86
221 0.79
222 0.76
223 0.71
224 0.65
225 0.6
226 0.53
227 0.44
228 0.36
229 0.33
230 0.25
231 0.19
232 0.14
233 0.1
234 0.1
235 0.11
236 0.12