Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E1H3

Protein Details
Accession A0A178E1H3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-77AYPQRTRNPKSRTRNGRKRARNKKKHTKASGQTNPTVHydrophilic
NLS Segment(s)
PositionSequence
45-68RTRNPKSRTRNGRKRARNKKKHTK
Subcellular Location(s) nucl 18, cyto_nucl 11.5, mito 6
Family & Domain DBs
Amino Acid Sequences MLTVSPVSRFFSTPSEAKDSQKNPGHSRRHNPRPPLSHCPAYPQRTRNPKSRTRNGRKRARNKKKHTKASGQTNPTVPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.34
4 0.36
5 0.42
6 0.4
7 0.45
8 0.48
9 0.5
10 0.5
11 0.57
12 0.64
13 0.63
14 0.71
15 0.72
16 0.76
17 0.78
18 0.78
19 0.76
20 0.75
21 0.75
22 0.73
23 0.68
24 0.61
25 0.54
26 0.54
27 0.53
28 0.5
29 0.49
30 0.45
31 0.48
32 0.54
33 0.58
34 0.6
35 0.6
36 0.65
37 0.69
38 0.75
39 0.78
40 0.79
41 0.86
42 0.87
43 0.9
44 0.9
45 0.92
46 0.93
47 0.93
48 0.93
49 0.93
50 0.95
51 0.95
52 0.95
53 0.93
54 0.92
55 0.9
56 0.9
57 0.89
58 0.84
59 0.78