Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DK90

Protein Details
Accession A0A178DK90   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
50-75LIKNPVSKSKCRKTSKQQHRCTASRHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MEICTAHTNANANAAGRKVHKFTTLSKHATIKPSICIASRKSRNRNELHLIKNPVSKSKCRKTSKQQHRCTASRHNSTQERTLIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.24
5 0.22
6 0.23
7 0.27
8 0.27
9 0.33
10 0.39
11 0.44
12 0.44
13 0.44
14 0.48
15 0.46
16 0.48
17 0.45
18 0.36
19 0.31
20 0.29
21 0.27
22 0.24
23 0.24
24 0.23
25 0.3
26 0.38
27 0.44
28 0.51
29 0.56
30 0.63
31 0.63
32 0.65
33 0.63
34 0.62
35 0.59
36 0.56
37 0.54
38 0.48
39 0.49
40 0.44
41 0.43
42 0.39
43 0.42
44 0.45
45 0.51
46 0.59
47 0.62
48 0.71
49 0.74
50 0.82
51 0.86
52 0.87
53 0.87
54 0.87
55 0.88
56 0.83
57 0.78
58 0.78
59 0.77
60 0.75
61 0.7
62 0.69
63 0.68
64 0.68
65 0.68