Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178E5G3

Protein Details
Accession A0A178E5G3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MRAKWRKKRVRRLKRKRRKTRARSTQQINYSPBasic
NLS Segment(s)
PositionSequence
3-23AKWRKKRVRRLKRKRRKTRAR
Subcellular Location(s) nucl 18.5, mito_nucl 13.333, cyto_nucl 10.666, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MRAKWRKKRVRRLKRKRRKTRARSTQQINYSPLNLSIYHLDLERTRLTNTTFSMHSLSASSQHLFNALRNPELRFTSYNKHVARERQSYYRRSDGAGPGNFRGCWSMIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.97
7 0.97
8 0.96
9 0.95
10 0.94
11 0.91
12 0.88
13 0.83
14 0.78
15 0.7
16 0.6
17 0.51
18 0.41
19 0.34
20 0.27
21 0.2
22 0.16
23 0.14
24 0.13
25 0.12
26 0.11
27 0.12
28 0.1
29 0.13
30 0.14
31 0.14
32 0.13
33 0.14
34 0.16
35 0.17
36 0.17
37 0.16
38 0.15
39 0.15
40 0.16
41 0.14
42 0.13
43 0.11
44 0.1
45 0.1
46 0.12
47 0.11
48 0.09
49 0.09
50 0.11
51 0.11
52 0.13
53 0.17
54 0.16
55 0.18
56 0.19
57 0.21
58 0.22
59 0.23
60 0.24
61 0.2
62 0.23
63 0.28
64 0.32
65 0.39
66 0.38
67 0.4
68 0.42
69 0.48
70 0.52
71 0.53
72 0.52
73 0.53
74 0.59
75 0.6
76 0.62
77 0.61
78 0.54
79 0.49
80 0.5
81 0.47
82 0.49
83 0.49
84 0.46
85 0.43
86 0.44
87 0.42
88 0.37
89 0.32