Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E8U5

Protein Details
Accession A0A178E8U5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
200-227DWTRLLSKTRSARRRRRQTNCSLPIRPPHydrophilic
NLS Segment(s)
PositionSequence
212-214RRR
Subcellular Location(s) mito 11, extr 6, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGAPRRLLSPLTLAAESHPALIHSTNVPIVPRAWCWMWPPSCVIGQLLVAVRRCAGGARPLRPGCELSHASLPAHPQPPTRAQPASQYSSLSCLAVGIQWSQYLGWGVVQRHKSILSGQLKHAPQYCVIWTGAVVAVKLSSLTRWLRRAENLLPGPFALVNALQLNVTVVTGSALRTGESGPTMRQPCERRQPQHVAGMDWTRLLSKTRSARRRRRQTNCSLPIRPPLPPAKPLSLPRHQSSLHVTVHPSFRRTSPRALDSEQHCLSHLYHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.24
4 0.2
5 0.16
6 0.13
7 0.15
8 0.15
9 0.16
10 0.12
11 0.14
12 0.14
13 0.16
14 0.16
15 0.15
16 0.17
17 0.17
18 0.17
19 0.2
20 0.2
21 0.21
22 0.24
23 0.31
24 0.31
25 0.3
26 0.32
27 0.31
28 0.31
29 0.29
30 0.26
31 0.18
32 0.16
33 0.18
34 0.17
35 0.18
36 0.17
37 0.16
38 0.16
39 0.15
40 0.15
41 0.13
42 0.13
43 0.18
44 0.24
45 0.27
46 0.36
47 0.37
48 0.38
49 0.39
50 0.39
51 0.32
52 0.33
53 0.31
54 0.25
55 0.29
56 0.28
57 0.26
58 0.26
59 0.27
60 0.26
61 0.27
62 0.25
63 0.23
64 0.27
65 0.34
66 0.37
67 0.38
68 0.34
69 0.32
70 0.38
71 0.42
72 0.42
73 0.36
74 0.32
75 0.28
76 0.29
77 0.29
78 0.21
79 0.15
80 0.1
81 0.09
82 0.08
83 0.09
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.06
91 0.06
92 0.07
93 0.1
94 0.11
95 0.17
96 0.18
97 0.18
98 0.19
99 0.19
100 0.18
101 0.16
102 0.24
103 0.25
104 0.26
105 0.27
106 0.33
107 0.33
108 0.34
109 0.36
110 0.28
111 0.22
112 0.22
113 0.21
114 0.16
115 0.15
116 0.13
117 0.1
118 0.09
119 0.1
120 0.08
121 0.07
122 0.05
123 0.05
124 0.05
125 0.05
126 0.04
127 0.03
128 0.07
129 0.11
130 0.14
131 0.18
132 0.2
133 0.22
134 0.24
135 0.29
136 0.26
137 0.32
138 0.31
139 0.28
140 0.26
141 0.24
142 0.23
143 0.18
144 0.15
145 0.08
146 0.05
147 0.06
148 0.06
149 0.06
150 0.05
151 0.05
152 0.06
153 0.05
154 0.05
155 0.04
156 0.03
157 0.04
158 0.04
159 0.04
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.09
168 0.09
169 0.16
170 0.18
171 0.19
172 0.25
173 0.29
174 0.36
175 0.46
176 0.54
177 0.52
178 0.58
179 0.65
180 0.62
181 0.66
182 0.59
183 0.5
184 0.44
185 0.42
186 0.34
187 0.26
188 0.22
189 0.16
190 0.15
191 0.16
192 0.14
193 0.19
194 0.28
195 0.38
196 0.48
197 0.57
198 0.68
199 0.76
200 0.86
201 0.89
202 0.91
203 0.9
204 0.91
205 0.92
206 0.9
207 0.88
208 0.81
209 0.73
210 0.71
211 0.64
212 0.55
213 0.5
214 0.49
215 0.44
216 0.46
217 0.48
218 0.45
219 0.49
220 0.55
221 0.57
222 0.58
223 0.6
224 0.57
225 0.58
226 0.53
227 0.5
228 0.49
229 0.48
230 0.42
231 0.38
232 0.37
233 0.36
234 0.44
235 0.44
236 0.39
237 0.34
238 0.37
239 0.44
240 0.46
241 0.5
242 0.5
243 0.53
244 0.56
245 0.58
246 0.61
247 0.56
248 0.61
249 0.54
250 0.46
251 0.41
252 0.37