Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EHB8

Protein Details
Accession A0A178EHB8    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-45MCPLSTTRRPSRPRRADPPAAIPLPTYTRSRTPPRRSFSRDPDAPHydrophilic
NLS Segment(s)
PositionSequence
105-134RGRGSDRGRGSDRGRGYGSGRGRGATANRR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MCPLSTTRRPSRPRRADPPAAIPLPTYTRSRTPPRRSFSRDPDAPWTATWERVRACSSCGCVNEIDSRKSAPTSVRPYHDYNDVPGPSSSRGGGTARGRGYDIARGRGSDRGRGSDRGRGYGSGRGRGATANRRPGGIRTFTPHDDAISEASVAAFAHTRTRTRTRARADRVRPAASAPTRREQGYRRIESGLDRGRGESSVNGNVRGVDAGEQEGTRAWIVRIWGWLRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.83
5 0.8
6 0.77
7 0.67
8 0.58
9 0.48
10 0.42
11 0.37
12 0.34
13 0.29
14 0.25
15 0.3
16 0.37
17 0.47
18 0.54
19 0.6
20 0.67
21 0.72
22 0.78
23 0.81
24 0.83
25 0.82
26 0.81
27 0.75
28 0.7
29 0.7
30 0.63
31 0.55
32 0.46
33 0.44
34 0.35
35 0.37
36 0.34
37 0.31
38 0.28
39 0.3
40 0.33
41 0.26
42 0.28
43 0.24
44 0.26
45 0.26
46 0.26
47 0.25
48 0.22
49 0.23
50 0.29
51 0.29
52 0.28
53 0.25
54 0.25
55 0.24
56 0.24
57 0.24
58 0.2
59 0.24
60 0.31
61 0.35
62 0.37
63 0.41
64 0.43
65 0.44
66 0.45
67 0.38
68 0.32
69 0.33
70 0.29
71 0.27
72 0.24
73 0.23
74 0.19
75 0.19
76 0.16
77 0.11
78 0.12
79 0.11
80 0.16
81 0.17
82 0.2
83 0.2
84 0.2
85 0.2
86 0.2
87 0.2
88 0.21
89 0.2
90 0.2
91 0.19
92 0.2
93 0.2
94 0.25
95 0.25
96 0.24
97 0.23
98 0.24
99 0.26
100 0.3
101 0.31
102 0.31
103 0.31
104 0.28
105 0.27
106 0.24
107 0.23
108 0.25
109 0.25
110 0.22
111 0.22
112 0.19
113 0.19
114 0.2
115 0.22
116 0.25
117 0.29
118 0.33
119 0.33
120 0.34
121 0.34
122 0.35
123 0.35
124 0.3
125 0.26
126 0.23
127 0.27
128 0.27
129 0.29
130 0.27
131 0.23
132 0.2
133 0.19
134 0.15
135 0.11
136 0.1
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.1
145 0.12
146 0.14
147 0.2
148 0.27
149 0.34
150 0.41
151 0.49
152 0.53
153 0.62
154 0.69
155 0.74
156 0.73
157 0.76
158 0.74
159 0.68
160 0.59
161 0.51
162 0.5
163 0.47
164 0.49
165 0.43
166 0.43
167 0.44
168 0.45
169 0.48
170 0.44
171 0.47
172 0.5
173 0.5
174 0.46
175 0.45
176 0.45
177 0.43
178 0.48
179 0.45
180 0.38
181 0.33
182 0.32
183 0.31
184 0.31
185 0.29
186 0.24
187 0.21
188 0.26
189 0.27
190 0.26
191 0.26
192 0.25
193 0.25
194 0.21
195 0.17
196 0.11
197 0.11
198 0.11
199 0.12
200 0.12
201 0.12
202 0.12
203 0.13
204 0.12
205 0.12
206 0.1
207 0.11
208 0.14
209 0.15
210 0.22