Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EMB1

Protein Details
Accession A0A178EMB1   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRHNRKRTRSRPRHRDGLNLQBasic
NLS Segment(s)
PositionSequence
3-17KRHNRKRTRSRPRHR
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MGKRHNRKRTRSRPRHRDGLNLQFQNHTRSVSVDTNSSHSSANSSYQPPYYPGANMPANHWHQTYFAWQDRLRSEQEREREVETQRLRIFGGEPGDEVTLLEPMLKVVTDLFDGFTDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.84
4 0.83
5 0.8
6 0.79
7 0.77
8 0.69
9 0.62
10 0.57
11 0.55
12 0.5
13 0.42
14 0.33
15 0.23
16 0.22
17 0.26
18 0.25
19 0.25
20 0.22
21 0.22
22 0.24
23 0.25
24 0.24
25 0.19
26 0.15
27 0.16
28 0.15
29 0.16
30 0.15
31 0.16
32 0.16
33 0.17
34 0.18
35 0.18
36 0.19
37 0.17
38 0.14
39 0.13
40 0.17
41 0.18
42 0.18
43 0.18
44 0.22
45 0.24
46 0.24
47 0.24
48 0.19
49 0.17
50 0.18
51 0.19
52 0.18
53 0.19
54 0.22
55 0.22
56 0.25
57 0.26
58 0.28
59 0.28
60 0.26
61 0.28
62 0.3
63 0.34
64 0.34
65 0.34
66 0.35
67 0.36
68 0.34
69 0.38
70 0.34
71 0.36
72 0.34
73 0.33
74 0.3
75 0.26
76 0.25
77 0.2
78 0.21
79 0.15
80 0.14
81 0.15
82 0.15
83 0.14
84 0.13
85 0.1
86 0.07
87 0.07
88 0.07
89 0.05
90 0.05
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.08
97 0.09
98 0.1
99 0.09
100 0.11
101 0.11