Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178EK07

Protein Details
Accession A0A178EK07    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRRRKRLNPLRRRRLHDRMPVSGBasic
NLS Segment(s)
PositionSequence
2-15RRRKRLNPLRRRRL
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MRRRKRLNPLRRRRLHDRMPVSGKTGGCTAALAAAGHIWCEGRGCRRHDAGREEARAQAQAPSLMDRTALPVAFIRDACMHSSVGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.85
4 0.8
5 0.78
6 0.75
7 0.68
8 0.62
9 0.56
10 0.47
11 0.38
12 0.32
13 0.23
14 0.17
15 0.16
16 0.12
17 0.08
18 0.08
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.06
29 0.12
30 0.17
31 0.21
32 0.24
33 0.28
34 0.32
35 0.36
36 0.4
37 0.42
38 0.44
39 0.44
40 0.41
41 0.39
42 0.36
43 0.32
44 0.27
45 0.21
46 0.15
47 0.13
48 0.13
49 0.13
50 0.14
51 0.13
52 0.13
53 0.11
54 0.14
55 0.15
56 0.14
57 0.12
58 0.14
59 0.16
60 0.18
61 0.18
62 0.17
63 0.18
64 0.19
65 0.21
66 0.2