Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H029

Protein Details
Accession I2H029    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-85MYMRKTINKRRIFKNQKQNSDPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 9, E.R. 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031430  Osw5  
Gene Ontology GO:0016020  C:membrane  
GO:0030435  P:sporulation resulting in formation of a cellular spore  
KEGG tbl:TBLA_0B09160  -  
Pfam View protein in Pfam  
PF17062  Osw5  
Amino Acid Sequences MFTISTIYFLIYLSIFIFIGLTSSIFIVPLLITSFVFATLVVIFGFISNSTLNLALWLFFKTNMYMRKTINKRRIFKNQKQNSDPDADPNATPIEQDENVLELNPIISTTQENN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.05
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.05
33 0.04
34 0.05
35 0.04
36 0.05
37 0.05
38 0.06
39 0.05
40 0.06
41 0.06
42 0.05
43 0.06
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.12
50 0.17
51 0.2
52 0.22
53 0.24
54 0.33
55 0.41
56 0.5
57 0.55
58 0.59
59 0.62
60 0.67
61 0.77
62 0.77
63 0.79
64 0.8
65 0.8
66 0.8
67 0.78
68 0.75
69 0.68
70 0.63
71 0.54
72 0.48
73 0.43
74 0.35
75 0.31
76 0.27
77 0.25
78 0.19
79 0.18
80 0.14
81 0.15
82 0.14
83 0.15
84 0.14
85 0.13
86 0.14
87 0.14
88 0.13
89 0.08
90 0.08
91 0.07
92 0.07
93 0.06
94 0.06