Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EJB7

Protein Details
Accession A0A178EJB7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-59LDHLGFKRGHRRRLQRHIASBasic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001660  SAM  
IPR013761  SAM/pointed_sf  
Pfam View protein in Pfam  
PF00536  SAM_1  
Amino Acid Sequences MDSELRDHLQRLDLSQYVAVLQENGYKSWTQLMAIDERDLDHLGFKRGHRRRLQRHIASMNGYPLSKALLSGDMETVQDQFRLNRGRRRPREFQLRTKAYPANKASVELNTESQSSQNTNPAEEHCRQRREVIRHYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.16
5 0.15
6 0.13
7 0.09
8 0.09
9 0.12
10 0.13
11 0.13
12 0.15
13 0.14
14 0.14
15 0.18
16 0.17
17 0.13
18 0.14
19 0.16
20 0.18
21 0.19
22 0.19
23 0.15
24 0.15
25 0.16
26 0.14
27 0.12
28 0.12
29 0.12
30 0.15
31 0.18
32 0.2
33 0.29
34 0.35
35 0.43
36 0.48
37 0.57
38 0.64
39 0.72
40 0.8
41 0.75
42 0.76
43 0.71
44 0.65
45 0.57
46 0.47
47 0.39
48 0.29
49 0.24
50 0.16
51 0.13
52 0.12
53 0.09
54 0.08
55 0.06
56 0.06
57 0.07
58 0.08
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.07
66 0.07
67 0.07
68 0.12
69 0.19
70 0.24
71 0.31
72 0.41
73 0.51
74 0.6
75 0.68
76 0.7
77 0.72
78 0.79
79 0.78
80 0.78
81 0.78
82 0.75
83 0.69
84 0.66
85 0.63
86 0.54
87 0.56
88 0.48
89 0.43
90 0.37
91 0.36
92 0.33
93 0.3
94 0.3
95 0.23
96 0.23
97 0.19
98 0.19
99 0.18
100 0.17
101 0.17
102 0.17
103 0.17
104 0.21
105 0.21
106 0.22
107 0.23
108 0.26
109 0.31
110 0.33
111 0.42
112 0.44
113 0.49
114 0.49
115 0.56
116 0.61
117 0.64
118 0.68