Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DN81

Protein Details
Accession A0A178DN81   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRLRRFGTSKRAARRGRRGSAVCHydrophilic
NLS Segment(s)
PositionSequence
9-18SKRAARRGRR
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences MRLRRFGTSKRAARRGRRGSAVCEGKRWPACTHDASTGGGAISMSVYGAAAQHVVWGRTAGCGRPGSESKRARALECGGAAARVRERGQLYACGVWWCRTGLVGRALSLLLSAAATDGQEAGALVGVGEVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.81
4 0.81
5 0.74
6 0.7
7 0.71
8 0.71
9 0.61
10 0.55
11 0.5
12 0.49
13 0.5
14 0.48
15 0.39
16 0.34
17 0.38
18 0.38
19 0.39
20 0.34
21 0.31
22 0.28
23 0.27
24 0.23
25 0.17
26 0.13
27 0.1
28 0.06
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.09
46 0.1
47 0.08
48 0.11
49 0.12
50 0.12
51 0.15
52 0.18
53 0.21
54 0.29
55 0.32
56 0.3
57 0.37
58 0.37
59 0.34
60 0.34
61 0.32
62 0.26
63 0.23
64 0.23
65 0.15
66 0.15
67 0.14
68 0.12
69 0.11
70 0.11
71 0.11
72 0.14
73 0.16
74 0.17
75 0.19
76 0.21
77 0.22
78 0.2
79 0.2
80 0.19
81 0.19
82 0.18
83 0.17
84 0.15
85 0.13
86 0.13
87 0.14
88 0.16
89 0.21
90 0.2
91 0.19
92 0.19
93 0.19
94 0.17
95 0.16
96 0.12
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04