Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EGJ6

Protein Details
Accession A0A178EGJ6   
Localization Confidence Low
Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-22TTLWRATRPHVLRRSCRQSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 12.833, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001907  ClpP  
IPR029045  ClpP/crotonase-like_dom_sf  
IPR023562  ClpP/TepA  
IPR033135  ClpP_His_AS  
IPR018215  ClpP_Ser_AS  
Gene Ontology GO:0004176  F:ATP-dependent peptidase activity  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00574  CLP_protease  
PROSITE View protein in PROSITE  
PS00382  CLP_PROTEASE_HIS  
PS00381  CLP_PROTEASE_SER  
CDD cd07017  S14_ClpP_2  
Amino Acid Sequences MATTLWRATRPHVLRRSCRQSARLMSSQFGFQPRLAPQQEDHTPRALSLPIPYVTETTGGGWKTSDIFSRLLQERIICLNGEVDDFMSANCVAQLLFLEADNPEKPISMYINSPGGSVSAGLAIYDTMNYIRCPVSTICMGIAASMGSLLLAGGAEGQRYILPHARVMIHQPSGGYRGKASDIADHAKEILRIRDKLNKIYQSHVTKKRTLEEIEKYMERDYFMDAQEAVEFGIVDKILEKREAPAKDEEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.8
4 0.78
5 0.79
6 0.73
7 0.73
8 0.73
9 0.72
10 0.68
11 0.6
12 0.54
13 0.49
14 0.47
15 0.41
16 0.36
17 0.3
18 0.23
19 0.26
20 0.27
21 0.34
22 0.33
23 0.32
24 0.3
25 0.36
26 0.43
27 0.44
28 0.43
29 0.38
30 0.36
31 0.34
32 0.34
33 0.27
34 0.2
35 0.17
36 0.19
37 0.16
38 0.18
39 0.18
40 0.17
41 0.17
42 0.16
43 0.14
44 0.11
45 0.14
46 0.13
47 0.13
48 0.12
49 0.12
50 0.13
51 0.13
52 0.14
53 0.13
54 0.14
55 0.15
56 0.22
57 0.24
58 0.23
59 0.23
60 0.21
61 0.21
62 0.21
63 0.21
64 0.14
65 0.12
66 0.12
67 0.11
68 0.11
69 0.09
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.08
88 0.08
89 0.09
90 0.08
91 0.08
92 0.08
93 0.09
94 0.1
95 0.09
96 0.1
97 0.11
98 0.13
99 0.13
100 0.13
101 0.12
102 0.1
103 0.09
104 0.08
105 0.07
106 0.04
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.06
118 0.06
119 0.06
120 0.09
121 0.09
122 0.11
123 0.11
124 0.11
125 0.1
126 0.1
127 0.1
128 0.07
129 0.07
130 0.05
131 0.04
132 0.03
133 0.03
134 0.02
135 0.02
136 0.02
137 0.02
138 0.02
139 0.02
140 0.03
141 0.03
142 0.03
143 0.03
144 0.04
145 0.04
146 0.05
147 0.07
148 0.11
149 0.12
150 0.13
151 0.15
152 0.16
153 0.16
154 0.2
155 0.22
156 0.19
157 0.18
158 0.18
159 0.17
160 0.2
161 0.22
162 0.18
163 0.14
164 0.15
165 0.16
166 0.18
167 0.18
168 0.17
169 0.19
170 0.22
171 0.22
172 0.21
173 0.2
174 0.19
175 0.21
176 0.19
177 0.23
178 0.25
179 0.27
180 0.3
181 0.39
182 0.41
183 0.46
184 0.52
185 0.53
186 0.49
187 0.52
188 0.57
189 0.57
190 0.64
191 0.65
192 0.62
193 0.6
194 0.62
195 0.62
196 0.59
197 0.55
198 0.53
199 0.51
200 0.51
201 0.51
202 0.49
203 0.45
204 0.41
205 0.37
206 0.31
207 0.24
208 0.23
209 0.21
210 0.2
211 0.2
212 0.19
213 0.18
214 0.17
215 0.16
216 0.12
217 0.08
218 0.08
219 0.06
220 0.08
221 0.07
222 0.07
223 0.09
224 0.12
225 0.14
226 0.16
227 0.16
228 0.2
229 0.28
230 0.31
231 0.32
232 0.36