Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DV33

Protein Details
Accession A0A178DV33   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-39PGGLNPPPLKRKRGRPRRHIILPPTPSSHydrophilic
NLS Segment(s)
PositionSequence
19-30PLKRKRGRPRRH
Subcellular Location(s) nucl 13, mito 10.5, cyto_mito 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSPFNAITATNPGGLNPPPLKRKRGRPRRHIILPPTPSSPSPAPPTPQSPLSSPPPPSPPPTPTPAPEETPIPRLNNPRKRVRIVNYHPNKAGKPFRMPFASNEEEAIPDAAAIEASRLRNPSAILPRMEHTEYLEPVTQRVSNGQGDIDRQDDSWCPEHRETEWSSWLFDLCSGSNFRVDSAQPDFEPDFERDFPAELLREEQEEGVSIFDDLHWAIVYAKTEGWDDKWFATEENIQEGAKRYRERVEGRPLTILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.27
4 0.32
5 0.4
6 0.45
7 0.54
8 0.59
9 0.69
10 0.73
11 0.8
12 0.83
13 0.84
14 0.9
15 0.91
16 0.92
17 0.9
18 0.87
19 0.86
20 0.81
21 0.74
22 0.66
23 0.59
24 0.49
25 0.46
26 0.4
27 0.35
28 0.35
29 0.35
30 0.36
31 0.37
32 0.42
33 0.4
34 0.42
35 0.39
36 0.35
37 0.36
38 0.39
39 0.4
40 0.38
41 0.38
42 0.41
43 0.41
44 0.44
45 0.44
46 0.43
47 0.42
48 0.45
49 0.44
50 0.4
51 0.43
52 0.41
53 0.39
54 0.35
55 0.35
56 0.32
57 0.33
58 0.34
59 0.3
60 0.32
61 0.39
62 0.48
63 0.53
64 0.58
65 0.62
66 0.65
67 0.68
68 0.71
69 0.68
70 0.68
71 0.67
72 0.71
73 0.68
74 0.67
75 0.65
76 0.6
77 0.54
78 0.51
79 0.5
80 0.43
81 0.44
82 0.41
83 0.42
84 0.43
85 0.43
86 0.38
87 0.39
88 0.37
89 0.29
90 0.28
91 0.24
92 0.2
93 0.19
94 0.16
95 0.08
96 0.05
97 0.05
98 0.04
99 0.04
100 0.03
101 0.04
102 0.06
103 0.06
104 0.08
105 0.09
106 0.09
107 0.1
108 0.11
109 0.16
110 0.2
111 0.22
112 0.22
113 0.22
114 0.23
115 0.25
116 0.25
117 0.2
118 0.16
119 0.15
120 0.15
121 0.15
122 0.16
123 0.13
124 0.13
125 0.14
126 0.12
127 0.1
128 0.11
129 0.12
130 0.11
131 0.11
132 0.12
133 0.11
134 0.12
135 0.12
136 0.12
137 0.1
138 0.09
139 0.1
140 0.11
141 0.13
142 0.17
143 0.18
144 0.22
145 0.22
146 0.24
147 0.24
148 0.28
149 0.27
150 0.26
151 0.29
152 0.25
153 0.24
154 0.23
155 0.22
156 0.17
157 0.15
158 0.13
159 0.08
160 0.1
161 0.11
162 0.11
163 0.13
164 0.13
165 0.13
166 0.13
167 0.13
168 0.16
169 0.18
170 0.19
171 0.17
172 0.21
173 0.21
174 0.19
175 0.22
176 0.2
177 0.2
178 0.18
179 0.2
180 0.17
181 0.18
182 0.17
183 0.17
184 0.16
185 0.13
186 0.15
187 0.14
188 0.15
189 0.14
190 0.14
191 0.12
192 0.11
193 0.11
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.07
200 0.06
201 0.06
202 0.06
203 0.06
204 0.07
205 0.09
206 0.1
207 0.1
208 0.11
209 0.12
210 0.13
211 0.14
212 0.17
213 0.19
214 0.19
215 0.19
216 0.21
217 0.21
218 0.2
219 0.22
220 0.24
221 0.22
222 0.25
223 0.26
224 0.23
225 0.24
226 0.29
227 0.32
228 0.34
229 0.35
230 0.34
231 0.39
232 0.48
233 0.52
234 0.55
235 0.6
236 0.59
237 0.59