Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178E172

Protein Details
Accession A0A178E172    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-87QALAMWKEKRKSKLKRDMHTTGKGIHydrophilic
NLS Segment(s)
PositionSequence
70-77EKRKSKLK
146-151KKNRLR
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0006139  P:nucleobase-containing compound metabolic process  
Amino Acid Sequences MKSDSYLTLCLEQAKKSPLHYKHGAIVVCGGKVIGQGYNDYRPGFNSGSVKTGRLPRRSLDGQALAMWKEKRKSKLKRDMHTTGKGIPDLCMPCEASHYGGKLTAPLSMHSEMMAIHSAISASSTSGFSAVSYGKKCFKLSGDSKKKNRLRGRAIRSYVEAVCVGSSAQFVASQCADQTRVQEEQVEKSRGERKVNNLCCKRYERGNKQQSCECPQYENRSLEPRIAAKDNRSCISKNLDPNRGPSPHSKDVGLKSIKNERGSLDPHRARGQSALMQKSFQDSHSVKERMKQGRLHGADLYVARLLPELGGKPAKQPIESVLQVDTNSSPPLCTGSLHEELVRRPVEETAKNEPSGPHTEQPATAGMSRPCYRCILYMESAGIKRVFWTTDSGDWEGAKIRELVDAVNGFGLEQTPETAAALNNVFVTKHEVQILRRVMENT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.38
4 0.47
5 0.46
6 0.52
7 0.55
8 0.54
9 0.54
10 0.58
11 0.52
12 0.43
13 0.43
14 0.36
15 0.31
16 0.27
17 0.2
18 0.14
19 0.15
20 0.16
21 0.12
22 0.1
23 0.15
24 0.19
25 0.23
26 0.26
27 0.26
28 0.25
29 0.25
30 0.29
31 0.27
32 0.27
33 0.28
34 0.26
35 0.31
36 0.32
37 0.32
38 0.31
39 0.39
40 0.43
41 0.45
42 0.47
43 0.43
44 0.51
45 0.53
46 0.51
47 0.49
48 0.44
49 0.38
50 0.38
51 0.38
52 0.3
53 0.32
54 0.32
55 0.3
56 0.34
57 0.4
58 0.46
59 0.54
60 0.64
61 0.7
62 0.77
63 0.82
64 0.84
65 0.86
66 0.86
67 0.84
68 0.8
69 0.72
70 0.65
71 0.59
72 0.51
73 0.43
74 0.35
75 0.32
76 0.27
77 0.25
78 0.23
79 0.2
80 0.19
81 0.21
82 0.21
83 0.18
84 0.19
85 0.19
86 0.17
87 0.17
88 0.17
89 0.16
90 0.15
91 0.15
92 0.13
93 0.13
94 0.17
95 0.17
96 0.17
97 0.15
98 0.15
99 0.12
100 0.13
101 0.13
102 0.08
103 0.07
104 0.07
105 0.07
106 0.06
107 0.07
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.06
116 0.08
117 0.1
118 0.13
119 0.14
120 0.17
121 0.23
122 0.25
123 0.26
124 0.26
125 0.27
126 0.32
127 0.39
128 0.48
129 0.54
130 0.61
131 0.67
132 0.75
133 0.78
134 0.78
135 0.78
136 0.77
137 0.76
138 0.77
139 0.79
140 0.78
141 0.76
142 0.68
143 0.62
144 0.55
145 0.45
146 0.36
147 0.27
148 0.18
149 0.14
150 0.12
151 0.09
152 0.06
153 0.06
154 0.04
155 0.04
156 0.05
157 0.06
158 0.08
159 0.08
160 0.08
161 0.08
162 0.09
163 0.11
164 0.11
165 0.13
166 0.14
167 0.15
168 0.15
169 0.19
170 0.19
171 0.22
172 0.28
173 0.28
174 0.25
175 0.28
176 0.35
177 0.35
178 0.39
179 0.37
180 0.39
181 0.47
182 0.56
183 0.61
184 0.6
185 0.58
186 0.58
187 0.59
188 0.53
189 0.52
190 0.55
191 0.55
192 0.6
193 0.68
194 0.68
195 0.66
196 0.68
197 0.63
198 0.59
199 0.53
200 0.43
201 0.37
202 0.36
203 0.4
204 0.41
205 0.39
206 0.35
207 0.36
208 0.36
209 0.33
210 0.31
211 0.25
212 0.21
213 0.23
214 0.23
215 0.22
216 0.27
217 0.29
218 0.29
219 0.29
220 0.27
221 0.26
222 0.31
223 0.3
224 0.34
225 0.38
226 0.44
227 0.42
228 0.45
229 0.48
230 0.43
231 0.41
232 0.39
233 0.41
234 0.39
235 0.39
236 0.37
237 0.36
238 0.37
239 0.43
240 0.39
241 0.31
242 0.3
243 0.37
244 0.4
245 0.37
246 0.36
247 0.29
248 0.3
249 0.33
250 0.34
251 0.35
252 0.33
253 0.35
254 0.38
255 0.37
256 0.34
257 0.32
258 0.3
259 0.25
260 0.3
261 0.31
262 0.27
263 0.27
264 0.27
265 0.29
266 0.27
267 0.21
268 0.23
269 0.19
270 0.23
271 0.31
272 0.34
273 0.31
274 0.36
275 0.44
276 0.43
277 0.48
278 0.48
279 0.44
280 0.51
281 0.52
282 0.49
283 0.41
284 0.34
285 0.31
286 0.27
287 0.23
288 0.13
289 0.11
290 0.09
291 0.09
292 0.08
293 0.06
294 0.08
295 0.07
296 0.1
297 0.13
298 0.13
299 0.16
300 0.21
301 0.22
302 0.21
303 0.21
304 0.21
305 0.25
306 0.26
307 0.24
308 0.2
309 0.2
310 0.19
311 0.2
312 0.18
313 0.12
314 0.13
315 0.12
316 0.1
317 0.09
318 0.12
319 0.11
320 0.11
321 0.13
322 0.18
323 0.21
324 0.22
325 0.23
326 0.23
327 0.24
328 0.3
329 0.27
330 0.21
331 0.19
332 0.23
333 0.27
334 0.29
335 0.34
336 0.37
337 0.4
338 0.4
339 0.4
340 0.37
341 0.36
342 0.38
343 0.37
344 0.31
345 0.31
346 0.32
347 0.31
348 0.32
349 0.29
350 0.24
351 0.21
352 0.23
353 0.21
354 0.26
355 0.31
356 0.31
357 0.31
358 0.32
359 0.32
360 0.31
361 0.34
362 0.33
363 0.31
364 0.31
365 0.31
366 0.33
367 0.32
368 0.31
369 0.27
370 0.2
371 0.19
372 0.19
373 0.18
374 0.15
375 0.19
376 0.2
377 0.24
378 0.29
379 0.29
380 0.29
381 0.27
382 0.27
383 0.27
384 0.24
385 0.21
386 0.17
387 0.16
388 0.16
389 0.17
390 0.16
391 0.16
392 0.17
393 0.15
394 0.15
395 0.14
396 0.12
397 0.12
398 0.12
399 0.08
400 0.08
401 0.08
402 0.09
403 0.09
404 0.1
405 0.11
406 0.1
407 0.13
408 0.13
409 0.12
410 0.12
411 0.13
412 0.12
413 0.12
414 0.2
415 0.19
416 0.21
417 0.27
418 0.3
419 0.31
420 0.41
421 0.45
422 0.39