Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EBD4

Protein Details
Accession A0A178EBD4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
222-241RRKAEVRAKRRAAENKEKARBasic
NLS Segment(s)
PositionSequence
221-241ERRKAEVRAKRRAAENKEKAR
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MILRRPLLNATSAVSASKTCVRNLQHSIPMRPVPKPIPFIPDHTAFLSAIGRGLSAHATKIPSWEALFTLTSPQLKELGVEPARSRRYLLQWREKFRNGEYGIGGDCQHVTDGVAELQLVQAIVPPNPQLGNTISPRSAAASATHDPGTRKFVVNVPAGAEASSLSVDTLPKVQGVLVKGAKTIKGSYVEPIKGSDGLRARIRLQEGMWEVRRGHTVDGGERRKAEVRAKRRAAENKEKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.16
4 0.23
5 0.22
6 0.21
7 0.28
8 0.32
9 0.39
10 0.46
11 0.49
12 0.5
13 0.54
14 0.56
15 0.55
16 0.57
17 0.53
18 0.47
19 0.47
20 0.44
21 0.44
22 0.47
23 0.42
24 0.43
25 0.42
26 0.46
27 0.44
28 0.42
29 0.38
30 0.33
31 0.33
32 0.26
33 0.25
34 0.2
35 0.15
36 0.12
37 0.1
38 0.08
39 0.07
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.13
47 0.16
48 0.16
49 0.15
50 0.15
51 0.15
52 0.13
53 0.13
54 0.13
55 0.11
56 0.13
57 0.13
58 0.14
59 0.14
60 0.14
61 0.14
62 0.13
63 0.13
64 0.12
65 0.18
66 0.18
67 0.19
68 0.2
69 0.26
70 0.28
71 0.28
72 0.28
73 0.24
74 0.31
75 0.39
76 0.46
77 0.49
78 0.55
79 0.61
80 0.66
81 0.67
82 0.61
83 0.53
84 0.53
85 0.43
86 0.38
87 0.31
88 0.26
89 0.22
90 0.2
91 0.19
92 0.1
93 0.09
94 0.07
95 0.07
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.04
109 0.05
110 0.05
111 0.06
112 0.06
113 0.07
114 0.07
115 0.07
116 0.07
117 0.09
118 0.13
119 0.14
120 0.16
121 0.15
122 0.16
123 0.16
124 0.15
125 0.14
126 0.1
127 0.1
128 0.13
129 0.14
130 0.16
131 0.17
132 0.17
133 0.17
134 0.18
135 0.22
136 0.19
137 0.19
138 0.18
139 0.21
140 0.25
141 0.26
142 0.25
143 0.21
144 0.2
145 0.19
146 0.18
147 0.14
148 0.09
149 0.07
150 0.07
151 0.05
152 0.04
153 0.05
154 0.05
155 0.06
156 0.08
157 0.07
158 0.07
159 0.08
160 0.08
161 0.1
162 0.12
163 0.17
164 0.18
165 0.18
166 0.2
167 0.21
168 0.22
169 0.21
170 0.2
171 0.18
172 0.19
173 0.19
174 0.23
175 0.28
176 0.28
177 0.27
178 0.28
179 0.26
180 0.25
181 0.25
182 0.26
183 0.23
184 0.27
185 0.3
186 0.31
187 0.31
188 0.33
189 0.36
190 0.32
191 0.28
192 0.3
193 0.3
194 0.35
195 0.36
196 0.35
197 0.33
198 0.33
199 0.36
200 0.3
201 0.28
202 0.24
203 0.24
204 0.29
205 0.38
206 0.41
207 0.41
208 0.41
209 0.43
210 0.44
211 0.47
212 0.49
213 0.49
214 0.54
215 0.61
216 0.67
217 0.69
218 0.74
219 0.78
220 0.78
221 0.79