Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2GY70

Protein Details
Accession I2GY70    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-70TWEKPLTARRRVHRRQNEHRSRRPWGBasic
NLS Segment(s)
PositionSequence
53-61RRRVHRRQN
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG tbl:TBLA_0B02300  -  
Amino Acid Sequences MFHSSKRLYCSNVDEIQLTGYDLEVYKNAEHILGFQRHKQGRLWTWEKPLTARRRVHRRQNEHRSRRPWGLEDTGSTLNSELLEYFTTLNNSESRCSSPQLPTSHTLIPVEPILVTTTTTKITTATTTAQPSRLAAFYRRVCASLAVHRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.3
4 0.25
5 0.19
6 0.12
7 0.09
8 0.08
9 0.08
10 0.08
11 0.08
12 0.1
13 0.1
14 0.11
15 0.11
16 0.11
17 0.1
18 0.12
19 0.18
20 0.23
21 0.25
22 0.28
23 0.37
24 0.38
25 0.41
26 0.41
27 0.42
28 0.41
29 0.49
30 0.5
31 0.46
32 0.5
33 0.52
34 0.49
35 0.45
36 0.48
37 0.46
38 0.5
39 0.53
40 0.54
41 0.62
42 0.69
43 0.76
44 0.78
45 0.8
46 0.82
47 0.87
48 0.89
49 0.88
50 0.89
51 0.83
52 0.78
53 0.74
54 0.65
55 0.57
56 0.49
57 0.43
58 0.35
59 0.3
60 0.29
61 0.24
62 0.21
63 0.18
64 0.14
65 0.11
66 0.1
67 0.09
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.07
75 0.08
76 0.09
77 0.1
78 0.11
79 0.12
80 0.13
81 0.16
82 0.17
83 0.19
84 0.21
85 0.23
86 0.28
87 0.3
88 0.32
89 0.31
90 0.33
91 0.32
92 0.3
93 0.27
94 0.21
95 0.2
96 0.16
97 0.14
98 0.1
99 0.09
100 0.09
101 0.08
102 0.09
103 0.09
104 0.1
105 0.12
106 0.12
107 0.12
108 0.11
109 0.12
110 0.13
111 0.14
112 0.16
113 0.18
114 0.24
115 0.25
116 0.27
117 0.26
118 0.26
119 0.26
120 0.25
121 0.24
122 0.22
123 0.3
124 0.32
125 0.37
126 0.37
127 0.35
128 0.34
129 0.35
130 0.35
131 0.35