Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178ENR8

Protein Details
Accession A0A178ENR8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
155-179GKSADQKPTKGKKRRARDIETQDTKBasic
226-250TAAQKSSKKSKSKGSKTSKKSTENSHydrophilic
NLS Segment(s)
PositionSequence
130-171RMAKERAKAALKARKINKKFEDEDEGKSADQKPTKGKKRRAR
232-244SKKSKSKGSKTSK
278-292AKAKKGRGRGKGKGK
Subcellular Location(s) nucl 15, cyto_nucl 13.333, cyto 10.5, mito_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MEPQTDLPDLVEDLEVNIDELAEALQPLLAAPIHTTASSLPLLDKSKLYVLTAYAIESLLFSALQASGTNAKEHPIFNELGRLKGYFAKIKEVEERGSQPKTKLDVGAAARFIKHGLAGNDKYDLQRAERMAKERAKAALKARKINKKFEDEDEGKSADQKPTKGKKRRARDIETQDTKDFSDDEILGGLEDPSTEEPTEPATKKARVSAVDHIETAGGDTSTSETAAQKSSKKSKSKGSKTSKKSTENSSADDSQTVRMPKTHSETLAALLDGSAAAKAKKGRGRGKGKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.07
19 0.09
20 0.1
21 0.1
22 0.1
23 0.09
24 0.13
25 0.13
26 0.12
27 0.11
28 0.15
29 0.19
30 0.2
31 0.2
32 0.19
33 0.22
34 0.23
35 0.23
36 0.19
37 0.17
38 0.18
39 0.17
40 0.16
41 0.12
42 0.12
43 0.1
44 0.09
45 0.09
46 0.06
47 0.05
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.12
55 0.13
56 0.15
57 0.14
58 0.16
59 0.18
60 0.18
61 0.18
62 0.17
63 0.17
64 0.16
65 0.24
66 0.23
67 0.22
68 0.23
69 0.21
70 0.19
71 0.22
72 0.25
73 0.22
74 0.22
75 0.28
76 0.28
77 0.31
78 0.35
79 0.33
80 0.32
81 0.3
82 0.34
83 0.32
84 0.35
85 0.34
86 0.3
87 0.32
88 0.33
89 0.32
90 0.28
91 0.23
92 0.25
93 0.26
94 0.26
95 0.24
96 0.21
97 0.19
98 0.18
99 0.18
100 0.12
101 0.1
102 0.1
103 0.1
104 0.16
105 0.17
106 0.18
107 0.19
108 0.2
109 0.19
110 0.19
111 0.18
112 0.13
113 0.16
114 0.17
115 0.2
116 0.22
117 0.25
118 0.29
119 0.32
120 0.31
121 0.3
122 0.33
123 0.3
124 0.31
125 0.36
126 0.36
127 0.37
128 0.43
129 0.49
130 0.54
131 0.55
132 0.6
133 0.57
134 0.57
135 0.55
136 0.51
137 0.51
138 0.44
139 0.43
140 0.37
141 0.33
142 0.26
143 0.26
144 0.25
145 0.21
146 0.21
147 0.21
148 0.28
149 0.37
150 0.47
151 0.55
152 0.63
153 0.68
154 0.76
155 0.84
156 0.84
157 0.81
158 0.81
159 0.81
160 0.81
161 0.78
162 0.7
163 0.61
164 0.52
165 0.46
166 0.36
167 0.27
168 0.17
169 0.13
170 0.1
171 0.09
172 0.09
173 0.08
174 0.08
175 0.07
176 0.07
177 0.04
178 0.04
179 0.05
180 0.06
181 0.07
182 0.07
183 0.07
184 0.08
185 0.12
186 0.18
187 0.18
188 0.21
189 0.24
190 0.27
191 0.28
192 0.32
193 0.33
194 0.3
195 0.34
196 0.37
197 0.39
198 0.37
199 0.36
200 0.32
201 0.28
202 0.24
203 0.21
204 0.13
205 0.07
206 0.05
207 0.05
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.1
214 0.14
215 0.17
216 0.2
217 0.28
218 0.38
219 0.45
220 0.52
221 0.56
222 0.63
223 0.71
224 0.77
225 0.8
226 0.81
227 0.83
228 0.83
229 0.89
230 0.87
231 0.84
232 0.79
233 0.76
234 0.76
235 0.69
236 0.65
237 0.61
238 0.54
239 0.46
240 0.44
241 0.37
242 0.28
243 0.3
244 0.27
245 0.22
246 0.23
247 0.25
248 0.3
249 0.36
250 0.39
251 0.35
252 0.37
253 0.36
254 0.36
255 0.35
256 0.28
257 0.21
258 0.15
259 0.14
260 0.1
261 0.09
262 0.07
263 0.07
264 0.07
265 0.11
266 0.15
267 0.23
268 0.28
269 0.38
270 0.46
271 0.55
272 0.65