Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DLA3

Protein Details
Accession A0A178DLA3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
139-166GDSRKIDSKAVKKPKKKAKAVKLTFGDEHydrophilic
NLS Segment(s)
PositionSequence
142-158RKIDSKAVKKPKKKAKA
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKAKDLQFGFSHLLDNSQPAFLRRLRGELTGDNSGRHDLPIPRNKRMKNDDEDDVPTYVLEDTNQSLTKEEYDALVAGKSPDDDQKPDSEVASKDQGSEAKSKPKDKIVEVGATVKKRKAVKIISEEDEGVERGAEGDSRKIDSKAVKKPKKKAKAVKLTFGDEEEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.18
4 0.2
5 0.18
6 0.16
7 0.17
8 0.16
9 0.21
10 0.2
11 0.27
12 0.25
13 0.28
14 0.28
15 0.3
16 0.32
17 0.32
18 0.35
19 0.35
20 0.34
21 0.31
22 0.3
23 0.29
24 0.26
25 0.22
26 0.22
27 0.21
28 0.3
29 0.38
30 0.43
31 0.49
32 0.57
33 0.59
34 0.64
35 0.66
36 0.64
37 0.61
38 0.61
39 0.55
40 0.51
41 0.51
42 0.43
43 0.36
44 0.28
45 0.21
46 0.17
47 0.13
48 0.1
49 0.07
50 0.06
51 0.07
52 0.09
53 0.11
54 0.1
55 0.11
56 0.11
57 0.12
58 0.11
59 0.1
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.06
70 0.09
71 0.1
72 0.11
73 0.12
74 0.14
75 0.16
76 0.16
77 0.15
78 0.14
79 0.14
80 0.15
81 0.17
82 0.16
83 0.14
84 0.15
85 0.17
86 0.16
87 0.21
88 0.2
89 0.26
90 0.31
91 0.34
92 0.36
93 0.41
94 0.43
95 0.39
96 0.43
97 0.37
98 0.35
99 0.32
100 0.36
101 0.34
102 0.34
103 0.34
104 0.3
105 0.32
106 0.32
107 0.34
108 0.36
109 0.38
110 0.43
111 0.49
112 0.54
113 0.52
114 0.5
115 0.47
116 0.4
117 0.34
118 0.26
119 0.18
120 0.12
121 0.08
122 0.07
123 0.07
124 0.08
125 0.08
126 0.12
127 0.13
128 0.16
129 0.19
130 0.19
131 0.23
132 0.3
133 0.37
134 0.44
135 0.54
136 0.61
137 0.68
138 0.78
139 0.84
140 0.87
141 0.89
142 0.89
143 0.89
144 0.9
145 0.88
146 0.88
147 0.83
148 0.77
149 0.68