Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DKI7

Protein Details
Accession A0A178DKI7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-129PPPVGHKPEKPLPKRPKPPKRKVGRTVBasic
NLS Segment(s)
PositionSequence
101-127RPPPPVGHKPEKPLPKRPKPPKRKVGR
Subcellular Location(s) extr 14, mito 6.5, cyto_mito 6.333, cyto 5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MHFSPSSITLLFAFTVHSLPPANAIPSCSPLVSSILNPVAWALYKQFYCDIASPPTSEGSGGVRFGEDGGLGGDSVVDSVLLGKVGQTIDKPVIVVVGHGRPPPPVGHKPEKPLPKRPKPPKRKVGRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.1
5 0.1
6 0.1
7 0.13
8 0.13
9 0.14
10 0.14
11 0.17
12 0.16
13 0.19
14 0.2
15 0.17
16 0.16
17 0.15
18 0.17
19 0.15
20 0.14
21 0.14
22 0.15
23 0.15
24 0.14
25 0.13
26 0.11
27 0.1
28 0.1
29 0.08
30 0.1
31 0.1
32 0.12
33 0.13
34 0.13
35 0.15
36 0.16
37 0.17
38 0.16
39 0.17
40 0.16
41 0.16
42 0.15
43 0.13
44 0.12
45 0.1
46 0.09
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.07
53 0.06
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.05
72 0.05
73 0.06
74 0.06
75 0.09
76 0.1
77 0.1
78 0.1
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.12
85 0.15
86 0.16
87 0.17
88 0.16
89 0.18
90 0.21
91 0.25
92 0.3
93 0.36
94 0.45
95 0.49
96 0.56
97 0.63
98 0.7
99 0.69
100 0.72
101 0.75
102 0.77
103 0.83
104 0.86
105 0.89
106 0.9
107 0.94
108 0.94
109 0.95