Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E4L2

Protein Details
Accession A0A178E4L2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
117-141ACPSARPIWPHPRPRLRRLLGRRASHydrophilic
NLS Segment(s)
PositionSequence
127-136HPRPRLRRLL
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MGRPQRSPRKIPLPRHLHTPANHPQLLTLIQGRYVKPEEYPRLLEAFPGTYFLLPLHPQVYLYFPTFPSASYISRSSTQLTPTPQAQTSAAYATASARCAQSSASSTRPTAGARPRACPSARPIWPHPRPRLRRLLGRRASAALLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.76
3 0.72
4 0.68
5 0.6
6 0.59
7 0.58
8 0.56
9 0.55
10 0.46
11 0.41
12 0.36
13 0.35
14 0.29
15 0.23
16 0.15
17 0.19
18 0.21
19 0.21
20 0.24
21 0.25
22 0.23
23 0.23
24 0.31
25 0.32
26 0.34
27 0.36
28 0.33
29 0.33
30 0.32
31 0.3
32 0.22
33 0.18
34 0.14
35 0.14
36 0.13
37 0.1
38 0.1
39 0.09
40 0.11
41 0.09
42 0.1
43 0.09
44 0.09
45 0.09
46 0.09
47 0.12
48 0.11
49 0.12
50 0.12
51 0.12
52 0.13
53 0.13
54 0.12
55 0.13
56 0.13
57 0.12
58 0.14
59 0.15
60 0.15
61 0.16
62 0.17
63 0.17
64 0.16
65 0.18
66 0.19
67 0.2
68 0.2
69 0.21
70 0.22
71 0.2
72 0.2
73 0.18
74 0.16
75 0.14
76 0.13
77 0.11
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.09
87 0.09
88 0.1
89 0.13
90 0.16
91 0.18
92 0.2
93 0.2
94 0.21
95 0.22
96 0.21
97 0.24
98 0.29
99 0.35
100 0.35
101 0.4
102 0.42
103 0.46
104 0.46
105 0.43
106 0.41
107 0.42
108 0.44
109 0.46
110 0.51
111 0.56
112 0.65
113 0.71
114 0.75
115 0.76
116 0.79
117 0.81
118 0.84
119 0.8
120 0.82
121 0.82
122 0.82
123 0.79
124 0.77
125 0.72
126 0.63