Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2H2P3

Protein Details
Accession I2H2P3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
120-141ELERRDRETRARKERAERARQGBasic
NLS Segment(s)
PositionSequence
124-139RDRETRARKERAERAR
Subcellular Location(s) mito 7, plas 6, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0016020  C:membrane  
KEGG tbl:TBLA_0D01370  -  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MSMPSSFETSSEEVDLHRLPFGAKVKYLCKQQPLVPIGCLLTTGAVVLAMKNVRMGRSRNAQVWLRWRVGLQALTLAALVGGGYYYAGVGASGRTQPDPQEQLKAMQKKTRRREQLWIEELERRDRETRARKERAERARQGPEGSGSGSGSGSGSESST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.16
4 0.15
5 0.13
6 0.13
7 0.18
8 0.23
9 0.22
10 0.24
11 0.27
12 0.32
13 0.38
14 0.46
15 0.44
16 0.45
17 0.46
18 0.47
19 0.52
20 0.52
21 0.48
22 0.4
23 0.36
24 0.3
25 0.26
26 0.22
27 0.13
28 0.08
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.04
35 0.06
36 0.06
37 0.06
38 0.09
39 0.1
40 0.12
41 0.16
42 0.18
43 0.21
44 0.29
45 0.32
46 0.32
47 0.37
48 0.37
49 0.37
50 0.42
51 0.42
52 0.35
53 0.32
54 0.29
55 0.26
56 0.25
57 0.23
58 0.15
59 0.11
60 0.1
61 0.09
62 0.09
63 0.07
64 0.05
65 0.04
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02
77 0.03
78 0.04
79 0.05
80 0.06
81 0.07
82 0.08
83 0.1
84 0.14
85 0.19
86 0.19
87 0.22
88 0.22
89 0.27
90 0.34
91 0.39
92 0.37
93 0.38
94 0.45
95 0.51
96 0.6
97 0.65
98 0.67
99 0.65
100 0.72
101 0.75
102 0.78
103 0.73
104 0.67
105 0.6
106 0.56
107 0.53
108 0.5
109 0.41
110 0.35
111 0.32
112 0.31
113 0.39
114 0.44
115 0.52
116 0.56
117 0.63
118 0.67
119 0.73
120 0.81
121 0.81
122 0.81
123 0.79
124 0.77
125 0.77
126 0.73
127 0.66
128 0.58
129 0.5
130 0.42
131 0.35
132 0.28
133 0.2
134 0.17
135 0.15
136 0.13
137 0.1
138 0.09
139 0.08