Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DM82

Protein Details
Accession A0A178DM82    Localization Confidence High Confidence Score 20.6
NoLS Segment(s)
PositionSequenceProtein Nature
117-137KTPAPKAKAGRPKKQAKKEATBasic
199-218KAPAAKAKGRPKKLIKKEATBasic
238-264EEKKVPAGKAKGRPKKQVKKEVTSEDEBasic
279-304AGEKKVPATKAKGRPKKQMKEAVSEDHydrophilic
NLS Segment(s)
PositionSequence
111-134KAEPKKKTPAPKAKAGRPKKQAKK
155-175ANEKKAPAAKAKGRPKKQAKG
195-215PEEKKAPAAKAKGRPKKLIKK
238-257EEKKVPAGKAKGRPKKQVKK
280-296GEKKVPATKAKGRPKKQ
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MPPKKAETTGEDSEFITGFSKKDCKLLAAAFLSSVGPDKYDYELMATLTNNTAGSLKKMWPPIKRKGIEAHDSFATFLGSAPVDKKRKAFDEGEDADDLDLVGNSPTAGDKAEPKKKTPAPKAKAGRPKKQAKKEATSEDEAGQSINETNPDKPANEKKAPAAKAKGRPKKQAKGATSEGQAGAATDEAISNDKPEEKKAPAAKAKGRPKKLIKKEATSEDEAVGATDEVIPDNKPAEEKKVPAGKAKGRPKKQVKKEVTSEDEAGEATDEIMADDKPAGEKKVPATKAKGRPKKQMKEAVSEDEAKIQAEANNDAVDEEVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.2
4 0.15
5 0.13
6 0.16
7 0.22
8 0.22
9 0.27
10 0.28
11 0.28
12 0.31
13 0.33
14 0.34
15 0.31
16 0.3
17 0.25
18 0.24
19 0.22
20 0.17
21 0.17
22 0.1
23 0.09
24 0.1
25 0.11
26 0.14
27 0.15
28 0.15
29 0.15
30 0.16
31 0.16
32 0.17
33 0.15
34 0.13
35 0.13
36 0.14
37 0.11
38 0.11
39 0.12
40 0.1
41 0.14
42 0.16
43 0.18
44 0.23
45 0.31
46 0.37
47 0.44
48 0.51
49 0.58
50 0.66
51 0.64
52 0.63
53 0.63
54 0.64
55 0.64
56 0.59
57 0.52
58 0.43
59 0.41
60 0.38
61 0.29
62 0.22
63 0.13
64 0.11
65 0.09
66 0.07
67 0.08
68 0.1
69 0.19
70 0.23
71 0.25
72 0.28
73 0.31
74 0.35
75 0.4
76 0.4
77 0.36
78 0.41
79 0.41
80 0.41
81 0.36
82 0.32
83 0.26
84 0.23
85 0.19
86 0.09
87 0.07
88 0.04
89 0.04
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.05
96 0.05
97 0.13
98 0.22
99 0.31
100 0.33
101 0.35
102 0.44
103 0.49
104 0.58
105 0.62
106 0.64
107 0.61
108 0.69
109 0.73
110 0.73
111 0.78
112 0.76
113 0.75
114 0.74
115 0.79
116 0.79
117 0.82
118 0.82
119 0.79
120 0.78
121 0.75
122 0.73
123 0.66
124 0.6
125 0.51
126 0.43
127 0.36
128 0.28
129 0.22
130 0.14
131 0.1
132 0.07
133 0.06
134 0.07
135 0.08
136 0.09
137 0.11
138 0.13
139 0.12
140 0.17
141 0.25
142 0.3
143 0.32
144 0.33
145 0.35
146 0.41
147 0.44
148 0.42
149 0.41
150 0.4
151 0.46
152 0.55
153 0.6
154 0.59
155 0.66
156 0.71
157 0.72
158 0.74
159 0.74
160 0.66
161 0.64
162 0.62
163 0.56
164 0.48
165 0.42
166 0.33
167 0.24
168 0.22
169 0.15
170 0.1
171 0.06
172 0.05
173 0.04
174 0.04
175 0.04
176 0.06
177 0.05
178 0.06
179 0.07
180 0.1
181 0.11
182 0.14
183 0.18
184 0.18
185 0.25
186 0.29
187 0.36
188 0.39
189 0.45
190 0.48
191 0.53
192 0.62
193 0.64
194 0.65
195 0.66
196 0.71
197 0.75
198 0.79
199 0.8
200 0.76
201 0.74
202 0.75
203 0.74
204 0.69
205 0.61
206 0.52
207 0.42
208 0.36
209 0.29
210 0.23
211 0.15
212 0.1
213 0.06
214 0.05
215 0.05
216 0.05
217 0.06
218 0.07
219 0.07
220 0.08
221 0.08
222 0.11
223 0.12
224 0.19
225 0.22
226 0.23
227 0.31
228 0.37
229 0.38
230 0.43
231 0.48
232 0.49
233 0.56
234 0.65
235 0.67
236 0.67
237 0.77
238 0.81
239 0.84
240 0.87
241 0.88
242 0.86
243 0.85
244 0.85
245 0.83
246 0.78
247 0.72
248 0.62
249 0.52
250 0.43
251 0.34
252 0.26
253 0.18
254 0.12
255 0.07
256 0.06
257 0.06
258 0.05
259 0.06
260 0.06
261 0.06
262 0.06
263 0.07
264 0.1
265 0.12
266 0.15
267 0.16
268 0.2
269 0.26
270 0.35
271 0.4
272 0.42
273 0.48
274 0.55
275 0.64
276 0.72
277 0.75
278 0.74
279 0.8
280 0.85
281 0.87
282 0.88
283 0.88
284 0.81
285 0.8
286 0.78
287 0.74
288 0.67
289 0.6
290 0.51
291 0.45
292 0.41
293 0.32
294 0.27
295 0.21
296 0.19
297 0.19
298 0.21
299 0.17
300 0.17
301 0.17
302 0.16