Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DJR7

Protein Details
Accession A0A178DJR7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
101-121GVFQLQKKMRRTKITRMWYRKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.166, mito 9, cyto 9, cyto_nucl 7.333, cyto_pero 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006137  NADH_UbQ_OxRdtase-like_20kDa  
IPR006138  NADH_UQ_OxRdtase_20Kd_su  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
GO:0048038  F:quinone binding  
Pfam View protein in Pfam  
PF01058  Oxidored_q6  
PROSITE View protein in PROSITE  
PS01150  COMPLEX1_20K  
Amino Acid Sequences MMHVSMPRYDQDRLGIIFRASPRQADVMIVAGTVTNKMGPALRLCYDQMPDPKWVISMGSCANGGGYYHYSYSVVRGVDRIVPVDIYIPGCPPTAEAVLYGVFQLQKKMRRTKITRMWYRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.21
4 0.24
5 0.24
6 0.28
7 0.25
8 0.24
9 0.24
10 0.23
11 0.23
12 0.2
13 0.18
14 0.13
15 0.12
16 0.11
17 0.09
18 0.08
19 0.08
20 0.07
21 0.07
22 0.05
23 0.05
24 0.05
25 0.07
26 0.07
27 0.09
28 0.12
29 0.14
30 0.15
31 0.16
32 0.17
33 0.17
34 0.2
35 0.22
36 0.21
37 0.21
38 0.2
39 0.2
40 0.18
41 0.17
42 0.13
43 0.09
44 0.1
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.07
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.1
60 0.11
61 0.1
62 0.09
63 0.1
64 0.11
65 0.13
66 0.13
67 0.13
68 0.1
69 0.1
70 0.1
71 0.11
72 0.11
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.12
81 0.11
82 0.11
83 0.1
84 0.11
85 0.11
86 0.11
87 0.1
88 0.09
89 0.1
90 0.1
91 0.16
92 0.21
93 0.28
94 0.37
95 0.47
96 0.54
97 0.63
98 0.69
99 0.74
100 0.79
101 0.82