Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DS69

Protein Details
Accession A0A178DS69    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGPKRKKQAPGPSTSRKGKKAKKAEAEEDBasic
NLS Segment(s)
PositionSequence
3-24PKRKKQAPGPSTSRKGKKAKKA
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009060  UBA-like_sf  
Pfam View protein in Pfam  
PF14555  UBA_4  
Amino Acid Sequences MGPKRKKQAPGPSTSRKGKKAKKAEAEEDDPTLYTSAQKAAITQFVNFTQLDRNTAARVLKNHAWDPQIAVNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.76
4 0.78
5 0.77
6 0.79
7 0.8
8 0.81
9 0.81
10 0.81
11 0.8
12 0.76
13 0.71
14 0.62
15 0.53
16 0.43
17 0.33
18 0.26
19 0.19
20 0.12
21 0.08
22 0.07
23 0.07
24 0.08
25 0.08
26 0.08
27 0.09
28 0.13
29 0.13
30 0.13
31 0.14
32 0.13
33 0.15
34 0.14
35 0.14
36 0.16
37 0.16
38 0.18
39 0.18
40 0.19
41 0.18
42 0.21
43 0.24
44 0.22
45 0.24
46 0.28
47 0.31
48 0.35
49 0.37
50 0.38
51 0.37
52 0.34
53 0.36