Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DST4

Protein Details
Accession A0A178DST4   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
368-398DEMPKKANPSPKKQKRNKRRQEPRIKYGPIPBasic
NLS Segment(s)
PositionSequence
372-393KKANPSPKKQKRNKRRQEPRIK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013178  Histone_AcTrfase_Rtt109/CBP  
IPR016849  Rtt109  
Gene Ontology GO:0005634  C:nucleus  
GO:0010484  F:histone H3 acetyltransferase activity  
GO:0016573  P:histone acetylation  
GO:0043618  P:regulation of transcription from RNA polymerase II promoter in response to stress  
Pfam View protein in Pfam  
PF08214  HAT_KAT11  
PROSITE View protein in PROSITE  
PS51728  RTT109_HAT  
Amino Acid Sequences MTNEHTSKPLKDLLAEQLPKDVPFTFHHYSTPPTKSSALFSAPPHGKSERTYCESHFLAASITQKETAASALPVELLILAIEVLIYTTRNLTTIFVSKADSTGYLSELQLPRSQAGSPLKVICGTFVSWLARERQREGKKLVISLFARAQDQYLFPASIENKKKHVLDDRGLVRWWCKVLDPIIWQYKAEDERKPFAERLLQAESAAVGTWSQTDATAKGYLVIPGFDPYETLRYIPQPSQPNTTRRWASTHPLLQIAPHPAAPPRCLVPHFPDDPKSRFLDELDEELPDRGTDAMVVEGGTPSRSNGQWKSVKTLDQFWEFMAFRQECSSGRIVGFIWVVITPPQPSIPEEDEVSLSQQSLSQTLSDEMPKKANPSPKKQKRNKRRQEPRIKYGPIPLVLPKIKTSSSNLSATSNASSTSSAKALPEKSPYYSWPINSRGTVCFSARNYNRAHEVLLQQSFANRRATAQSTKKWKEEIGVLGGMEDWSWTVIGKKEESTASVTSTNRVMPTVVMGVRKKRKPDAESSATQINGTTVVQTLGEGLVRKKAKIEPLQASEPNADGVNMLSANLVRKKGTVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.43
3 0.39
4 0.4
5 0.4
6 0.38
7 0.36
8 0.29
9 0.23
10 0.24
11 0.32
12 0.3
13 0.3
14 0.33
15 0.33
16 0.38
17 0.42
18 0.44
19 0.37
20 0.37
21 0.38
22 0.37
23 0.39
24 0.38
25 0.34
26 0.33
27 0.33
28 0.39
29 0.41
30 0.4
31 0.41
32 0.38
33 0.36
34 0.37
35 0.44
36 0.43
37 0.43
38 0.45
39 0.43
40 0.47
41 0.45
42 0.42
43 0.34
44 0.26
45 0.22
46 0.22
47 0.24
48 0.2
49 0.2
50 0.19
51 0.18
52 0.18
53 0.18
54 0.16
55 0.12
56 0.1
57 0.1
58 0.09
59 0.09
60 0.08
61 0.08
62 0.06
63 0.05
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.04
73 0.05
74 0.06
75 0.07
76 0.08
77 0.09
78 0.1
79 0.13
80 0.17
81 0.18
82 0.18
83 0.2
84 0.19
85 0.19
86 0.19
87 0.16
88 0.13
89 0.13
90 0.13
91 0.13
92 0.13
93 0.2
94 0.2
95 0.22
96 0.23
97 0.23
98 0.23
99 0.22
100 0.22
101 0.22
102 0.26
103 0.27
104 0.27
105 0.27
106 0.27
107 0.28
108 0.27
109 0.21
110 0.17
111 0.15
112 0.13
113 0.15
114 0.15
115 0.15
116 0.17
117 0.23
118 0.27
119 0.29
120 0.32
121 0.4
122 0.45
123 0.51
124 0.53
125 0.54
126 0.51
127 0.52
128 0.49
129 0.46
130 0.4
131 0.37
132 0.36
133 0.29
134 0.28
135 0.24
136 0.23
137 0.17
138 0.17
139 0.16
140 0.14
141 0.13
142 0.12
143 0.16
144 0.18
145 0.25
146 0.32
147 0.32
148 0.34
149 0.38
150 0.39
151 0.4
152 0.47
153 0.45
154 0.42
155 0.48
156 0.48
157 0.45
158 0.46
159 0.41
160 0.33
161 0.29
162 0.26
163 0.18
164 0.15
165 0.16
166 0.17
167 0.21
168 0.23
169 0.27
170 0.32
171 0.32
172 0.31
173 0.28
174 0.31
175 0.33
176 0.33
177 0.32
178 0.29
179 0.34
180 0.37
181 0.4
182 0.35
183 0.31
184 0.34
185 0.3
186 0.31
187 0.3
188 0.27
189 0.24
190 0.23
191 0.21
192 0.15
193 0.13
194 0.08
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.06
202 0.06
203 0.08
204 0.09
205 0.09
206 0.1
207 0.1
208 0.11
209 0.1
210 0.1
211 0.08
212 0.09
213 0.09
214 0.08
215 0.08
216 0.08
217 0.1
218 0.1
219 0.1
220 0.1
221 0.12
222 0.15
223 0.17
224 0.22
225 0.27
226 0.29
227 0.36
228 0.4
229 0.42
230 0.43
231 0.48
232 0.44
233 0.38
234 0.41
235 0.36
236 0.36
237 0.39
238 0.4
239 0.34
240 0.34
241 0.32
242 0.28
243 0.28
244 0.25
245 0.18
246 0.15
247 0.14
248 0.15
249 0.17
250 0.17
251 0.15
252 0.14
253 0.15
254 0.16
255 0.18
256 0.2
257 0.24
258 0.27
259 0.27
260 0.32
261 0.35
262 0.36
263 0.36
264 0.33
265 0.29
266 0.26
267 0.25
268 0.22
269 0.18
270 0.19
271 0.16
272 0.14
273 0.14
274 0.13
275 0.13
276 0.08
277 0.08
278 0.05
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.04
289 0.04
290 0.05
291 0.07
292 0.07
293 0.12
294 0.13
295 0.21
296 0.26
297 0.27
298 0.32
299 0.32
300 0.35
301 0.32
302 0.36
303 0.32
304 0.3
305 0.29
306 0.24
307 0.26
308 0.23
309 0.22
310 0.23
311 0.19
312 0.17
313 0.18
314 0.19
315 0.15
316 0.18
317 0.19
318 0.13
319 0.13
320 0.14
321 0.13
322 0.13
323 0.12
324 0.09
325 0.08
326 0.06
327 0.07
328 0.07
329 0.08
330 0.07
331 0.07
332 0.08
333 0.09
334 0.09
335 0.14
336 0.15
337 0.15
338 0.15
339 0.16
340 0.16
341 0.15
342 0.16
343 0.11
344 0.09
345 0.08
346 0.09
347 0.09
348 0.09
349 0.09
350 0.08
351 0.09
352 0.1
353 0.11
354 0.13
355 0.15
356 0.16
357 0.18
358 0.19
359 0.22
360 0.25
361 0.33
362 0.37
363 0.45
364 0.55
365 0.63
366 0.73
367 0.8
368 0.86
369 0.88
370 0.93
371 0.93
372 0.93
373 0.94
374 0.94
375 0.96
376 0.94
377 0.91
378 0.9
379 0.82
380 0.73
381 0.68
382 0.61
383 0.51
384 0.43
385 0.36
386 0.34
387 0.32
388 0.31
389 0.26
390 0.24
391 0.24
392 0.24
393 0.27
394 0.27
395 0.3
396 0.31
397 0.3
398 0.29
399 0.29
400 0.28
401 0.25
402 0.18
403 0.13
404 0.12
405 0.12
406 0.12
407 0.13
408 0.12
409 0.12
410 0.13
411 0.17
412 0.19
413 0.21
414 0.26
415 0.26
416 0.29
417 0.3
418 0.31
419 0.33
420 0.34
421 0.34
422 0.34
423 0.36
424 0.36
425 0.36
426 0.37
427 0.31
428 0.33
429 0.33
430 0.28
431 0.29
432 0.28
433 0.36
434 0.36
435 0.39
436 0.36
437 0.37
438 0.4
439 0.36
440 0.36
441 0.3
442 0.31
443 0.32
444 0.31
445 0.29
446 0.24
447 0.27
448 0.28
449 0.27
450 0.27
451 0.21
452 0.22
453 0.26
454 0.31
455 0.37
456 0.41
457 0.46
458 0.53
459 0.59
460 0.61
461 0.58
462 0.54
463 0.49
464 0.47
465 0.43
466 0.36
467 0.32
468 0.28
469 0.25
470 0.24
471 0.2
472 0.14
473 0.1
474 0.05
475 0.04
476 0.05
477 0.05
478 0.07
479 0.11
480 0.15
481 0.17
482 0.18
483 0.21
484 0.22
485 0.23
486 0.25
487 0.23
488 0.22
489 0.25
490 0.25
491 0.23
492 0.25
493 0.25
494 0.21
495 0.21
496 0.18
497 0.14
498 0.16
499 0.18
500 0.19
501 0.23
502 0.27
503 0.36
504 0.46
505 0.51
506 0.55
507 0.6
508 0.66
509 0.66
510 0.72
511 0.72
512 0.7
513 0.68
514 0.66
515 0.62
516 0.53
517 0.46
518 0.36
519 0.27
520 0.21
521 0.17
522 0.13
523 0.09
524 0.09
525 0.09
526 0.09
527 0.09
528 0.08
529 0.1
530 0.11
531 0.12
532 0.2
533 0.22
534 0.22
535 0.26
536 0.31
537 0.39
538 0.45
539 0.53
540 0.54
541 0.59
542 0.66
543 0.63
544 0.61
545 0.53
546 0.45
547 0.37
548 0.29
549 0.22
550 0.15
551 0.13
552 0.12
553 0.1
554 0.1
555 0.09
556 0.1
557 0.17
558 0.21
559 0.23
560 0.21