Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E7B9

Protein Details
Accession A0A178E7B9    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30TVGTTCSMRARRKSRIKEKGNWEIVEHydrophilic
NLS Segment(s)
PositionSequence
16-17RK
Subcellular Location(s) mito_nucl 11.166, nucl 11, mito 11
Family & Domain DBs
Amino Acid Sequences MPRGTVGTTCSMRARRKSRIKEKGNWEIVETNCYPKLDFRSRRCSGRFPAGFQPQPNSNSTRRSLQVRKSSSGSFKPGVLKRQASNDTSDLAQYPGLPGDEKPSQAVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.68
4 0.76
5 0.81
6 0.84
7 0.85
8 0.85
9 0.86
10 0.86
11 0.83
12 0.72
13 0.64
14 0.58
15 0.5
16 0.46
17 0.38
18 0.31
19 0.26
20 0.25
21 0.23
22 0.2
23 0.28
24 0.33
25 0.41
26 0.44
27 0.51
28 0.55
29 0.61
30 0.61
31 0.59
32 0.53
33 0.55
34 0.5
35 0.44
36 0.48
37 0.48
38 0.47
39 0.41
40 0.4
41 0.33
42 0.34
43 0.32
44 0.28
45 0.24
46 0.26
47 0.28
48 0.29
49 0.28
50 0.34
51 0.38
52 0.42
53 0.49
54 0.49
55 0.5
56 0.5
57 0.5
58 0.48
59 0.46
60 0.43
61 0.35
62 0.33
63 0.38
64 0.38
65 0.41
66 0.42
67 0.42
68 0.39
69 0.46
70 0.49
71 0.42
72 0.43
73 0.38
74 0.33
75 0.3
76 0.28
77 0.21
78 0.17
79 0.15
80 0.11
81 0.11
82 0.1
83 0.11
84 0.11
85 0.1
86 0.16
87 0.19
88 0.2