Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DRF4

Protein Details
Accession A0A178DRF4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
25-45KYAFSKLKMRYHPKNNNPGTSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MPASNFRDYYEDLELLFGASQAEIKYAFSKLKMRYHPKNNNPGTSDAVKYRRVGEAFTRLSDPYSKPDYDKGYHFFKEEADRASIEVGEAGGTRTEQFDADEPLPRPSPPPVKPHREGDEDGWIYRGEEYRASQAYKEWEKKAEEYLARHPER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.17
3 0.15
4 0.1
5 0.06
6 0.06
7 0.07
8 0.06
9 0.07
10 0.07
11 0.08
12 0.1
13 0.12
14 0.14
15 0.16
16 0.23
17 0.28
18 0.36
19 0.44
20 0.52
21 0.6
22 0.69
23 0.77
24 0.79
25 0.84
26 0.8
27 0.77
28 0.7
29 0.63
30 0.57
31 0.49
32 0.42
33 0.37
34 0.35
35 0.32
36 0.3
37 0.3
38 0.29
39 0.26
40 0.26
41 0.24
42 0.28
43 0.27
44 0.27
45 0.27
46 0.23
47 0.24
48 0.25
49 0.22
50 0.19
51 0.21
52 0.21
53 0.21
54 0.25
55 0.28
56 0.27
57 0.29
58 0.28
59 0.28
60 0.28
61 0.28
62 0.24
63 0.21
64 0.23
65 0.22
66 0.2
67 0.16
68 0.16
69 0.15
70 0.15
71 0.13
72 0.09
73 0.07
74 0.05
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.06
83 0.06
84 0.07
85 0.08
86 0.11
87 0.12
88 0.17
89 0.17
90 0.2
91 0.21
92 0.2
93 0.21
94 0.23
95 0.31
96 0.31
97 0.4
98 0.45
99 0.53
100 0.58
101 0.63
102 0.63
103 0.6
104 0.58
105 0.52
106 0.53
107 0.46
108 0.41
109 0.35
110 0.29
111 0.24
112 0.23
113 0.21
114 0.13
115 0.14
116 0.16
117 0.21
118 0.24
119 0.25
120 0.24
121 0.25
122 0.33
123 0.39
124 0.44
125 0.42
126 0.44
127 0.47
128 0.49
129 0.51
130 0.5
131 0.46
132 0.44
133 0.5