Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E098

Protein Details
Accession A0A178E098    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKSTRGKGKKEAVGKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
4-28EKSTRGKGKKEAVGKKKKDPNAPKR
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSTRGKGKKEAVGKKKKDPNAPKRGLSAYMFFANEQRDKVREDNPGIKFGEVGKLLGEKWKALSEKQRTPYEAKAATDKKRYEEEKAAYAAGEEEEEESE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.82
4 0.79
5 0.8
6 0.81
7 0.8
8 0.81
9 0.82
10 0.82
11 0.82
12 0.82
13 0.74
14 0.7
15 0.64
16 0.57
17 0.48
18 0.39
19 0.31
20 0.27
21 0.25
22 0.2
23 0.2
24 0.2
25 0.19
26 0.19
27 0.17
28 0.17
29 0.19
30 0.22
31 0.24
32 0.26
33 0.28
34 0.35
35 0.34
36 0.36
37 0.34
38 0.3
39 0.27
40 0.22
41 0.21
42 0.14
43 0.12
44 0.09
45 0.09
46 0.1
47 0.13
48 0.13
49 0.09
50 0.1
51 0.15
52 0.15
53 0.18
54 0.27
55 0.32
56 0.39
57 0.46
58 0.49
59 0.48
60 0.51
61 0.52
62 0.51
63 0.46
64 0.4
65 0.42
66 0.45
67 0.48
68 0.52
69 0.5
70 0.47
71 0.52
72 0.53
73 0.51
74 0.53
75 0.5
76 0.47
77 0.47
78 0.43
79 0.34
80 0.31
81 0.25
82 0.17
83 0.13
84 0.09