Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DGQ8

Protein Details
Accession A0A178DGQ8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
89-108RETVLKKLRRLKKEMRRLELBasic
NLS Segment(s)
PositionSequence
95-102KLRRLKKE
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MEPNQYETMASPQKSTCSESTEVDDTFTQDVLQTRPSVPNEDTFFSERARSSSGEGIHTAAKNKGSNSKICARSSLLSRPNSTYALIGRETVLKKLRRLKKEMRRLELPVWRADKDGGCQARISITVRKHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.29
4 0.28
5 0.3
6 0.29
7 0.33
8 0.33
9 0.3
10 0.27
11 0.26
12 0.22
13 0.2
14 0.18
15 0.12
16 0.11
17 0.13
18 0.12
19 0.14
20 0.13
21 0.14
22 0.19
23 0.21
24 0.23
25 0.23
26 0.27
27 0.28
28 0.28
29 0.29
30 0.27
31 0.27
32 0.23
33 0.24
34 0.19
35 0.18
36 0.18
37 0.16
38 0.16
39 0.18
40 0.18
41 0.17
42 0.17
43 0.17
44 0.17
45 0.17
46 0.16
47 0.14
48 0.15
49 0.15
50 0.16
51 0.21
52 0.21
53 0.23
54 0.25
55 0.32
56 0.35
57 0.34
58 0.35
59 0.3
60 0.3
61 0.32
62 0.35
63 0.34
64 0.32
65 0.33
66 0.34
67 0.33
68 0.32
69 0.29
70 0.23
71 0.18
72 0.17
73 0.16
74 0.14
75 0.12
76 0.17
77 0.17
78 0.2
79 0.26
80 0.27
81 0.33
82 0.42
83 0.51
84 0.53
85 0.61
86 0.67
87 0.71
88 0.78
89 0.81
90 0.79
91 0.75
92 0.73
93 0.73
94 0.69
95 0.61
96 0.58
97 0.52
98 0.45
99 0.41
100 0.39
101 0.34
102 0.3
103 0.36
104 0.32
105 0.29
106 0.28
107 0.27
108 0.26
109 0.27
110 0.27
111 0.25