Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DWM3

Protein Details
Accession A0A178DWM3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
199-219EYPLRSLQPRRKKRVSSEVVPHydrophilic
237-263SGTISRASLRRPRRRNFTARRGVRLKLHydrophilic
NLS Segment(s)
PositionSequence
245-258LRRPRRRNFTARRG
Subcellular Location(s) cyto_nucl 9.5, nucl 9, mito 9, cyto 8
Family & Domain DBs
Amino Acid Sequences MGTTLGTTAVISREPRYSPPPSPRVYMTASESAFRGVGHVPRTRRSKVSSPITEAHIPPEPAATTEHPVAFIDPDYRPIVTASQEPPRTDDFKDDITDDVTDDPPPFPGEGYDETRTQEKAAGTVSHGVRPLPSLKPHPKNKDVSEAVPPLPEGEYDETRTERKAAGTVSHGDRPLLPEEGHGKTRTKIIASGTISKGEYPLRSLQPRRKKRVSSEVVPPLPPEEGYDKTRTQIKASGTISRASLRRPRRRNFTARRGVRLKLYHHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.27
3 0.32
4 0.37
5 0.43
6 0.5
7 0.56
8 0.55
9 0.57
10 0.55
11 0.53
12 0.5
13 0.46
14 0.41
15 0.39
16 0.37
17 0.33
18 0.31
19 0.27
20 0.23
21 0.19
22 0.16
23 0.13
24 0.16
25 0.21
26 0.27
27 0.29
28 0.37
29 0.44
30 0.47
31 0.49
32 0.52
33 0.55
34 0.58
35 0.65
36 0.62
37 0.61
38 0.6
39 0.6
40 0.57
41 0.48
42 0.42
43 0.36
44 0.31
45 0.26
46 0.25
47 0.19
48 0.16
49 0.19
50 0.18
51 0.17
52 0.19
53 0.18
54 0.17
55 0.17
56 0.17
57 0.14
58 0.13
59 0.13
60 0.11
61 0.14
62 0.15
63 0.14
64 0.14
65 0.14
66 0.15
67 0.13
68 0.17
69 0.17
70 0.24
71 0.27
72 0.27
73 0.29
74 0.32
75 0.33
76 0.29
77 0.31
78 0.25
79 0.24
80 0.25
81 0.23
82 0.2
83 0.18
84 0.17
85 0.13
86 0.12
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.1
93 0.09
94 0.08
95 0.07
96 0.1
97 0.12
98 0.17
99 0.18
100 0.18
101 0.19
102 0.21
103 0.21
104 0.18
105 0.18
106 0.13
107 0.12
108 0.12
109 0.12
110 0.11
111 0.16
112 0.17
113 0.15
114 0.15
115 0.14
116 0.13
117 0.14
118 0.16
119 0.13
120 0.15
121 0.22
122 0.3
123 0.4
124 0.48
125 0.54
126 0.57
127 0.61
128 0.6
129 0.61
130 0.54
131 0.47
132 0.44
133 0.39
134 0.33
135 0.28
136 0.25
137 0.17
138 0.15
139 0.13
140 0.1
141 0.11
142 0.12
143 0.14
144 0.15
145 0.16
146 0.17
147 0.18
148 0.17
149 0.14
150 0.13
151 0.13
152 0.13
153 0.13
154 0.15
155 0.19
156 0.21
157 0.23
158 0.22
159 0.2
160 0.2
161 0.21
162 0.2
163 0.18
164 0.15
165 0.14
166 0.18
167 0.21
168 0.24
169 0.23
170 0.23
171 0.22
172 0.26
173 0.26
174 0.22
175 0.22
176 0.21
177 0.27
178 0.28
179 0.33
180 0.3
181 0.31
182 0.3
183 0.27
184 0.27
185 0.22
186 0.19
187 0.17
188 0.22
189 0.26
190 0.34
191 0.42
192 0.5
193 0.58
194 0.68
195 0.74
196 0.78
197 0.79
198 0.79
199 0.83
200 0.81
201 0.76
202 0.75
203 0.75
204 0.69
205 0.62
206 0.54
207 0.45
208 0.37
209 0.32
210 0.25
211 0.19
212 0.21
213 0.24
214 0.29
215 0.28
216 0.3
217 0.37
218 0.35
219 0.34
220 0.35
221 0.34
222 0.38
223 0.4
224 0.44
225 0.39
226 0.39
227 0.38
228 0.38
229 0.36
230 0.34
231 0.41
232 0.44
233 0.54
234 0.62
235 0.69
236 0.74
237 0.83
238 0.87
239 0.89
240 0.89
241 0.89
242 0.86
243 0.87
244 0.81
245 0.75
246 0.73
247 0.68