Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DKU9

Protein Details
Accession A0A178DKU9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
52-71GYQQQAPPPRQKKDRGCLAAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MSAQGYYQGGSAPQYPQQSYGPPGHQQQYAQQPYGGPPPQQQQMYYGPPQGGYQQQAPPPRQKKDRGCLAAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.24
5 0.25
6 0.26
7 0.29
8 0.28
9 0.28
10 0.31
11 0.31
12 0.31
13 0.29
14 0.31
15 0.36
16 0.36
17 0.32
18 0.29
19 0.26
20 0.26
21 0.31
22 0.27
23 0.18
24 0.18
25 0.21
26 0.25
27 0.25
28 0.24
29 0.22
30 0.25
31 0.28
32 0.28
33 0.26
34 0.22
35 0.22
36 0.22
37 0.21
38 0.19
39 0.18
40 0.2
41 0.23
42 0.27
43 0.34
44 0.38
45 0.46
46 0.51
47 0.57
48 0.61
49 0.67
50 0.72
51 0.75
52 0.82