Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178E447

Protein Details
Accession A0A178E447    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-74AERRRIQNRIAQRNYRKKLKKRLEDLERRAASHydrophilic
NLS Segment(s)
PositionSequence
53-64AQRNYRKKLKKR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MHRHASYQYATAAPTTTRYSGTSSAFSASANPNEDWTKISDLAERRRIQNRIAQRNYRKKLKKRLEDLERRAASSSASPEQKPAELQPPHRSPRQEFPSPSSSESSYTTPPAEDRMFSHQYTRQLSTSPPPFSVASYSSAYPAPDAVAYSMPYSTSPYHSIPTTMTPEMPSYAYLPPPLSSAYPTTLPSLVPSMKSEYYAEEDLSPFGVGYAAIGGIEIPPPHAYADSTAHVRLPTRQPYYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.19
5 0.2
6 0.23
7 0.26
8 0.28
9 0.27
10 0.24
11 0.24
12 0.23
13 0.21
14 0.21
15 0.21
16 0.22
17 0.24
18 0.23
19 0.24
20 0.25
21 0.26
22 0.23
23 0.22
24 0.23
25 0.2
26 0.21
27 0.24
28 0.29
29 0.37
30 0.44
31 0.45
32 0.47
33 0.53
34 0.54
35 0.52
36 0.53
37 0.55
38 0.57
39 0.62
40 0.66
41 0.69
42 0.78
43 0.82
44 0.85
45 0.84
46 0.83
47 0.86
48 0.87
49 0.86
50 0.84
51 0.87
52 0.87
53 0.88
54 0.85
55 0.84
56 0.74
57 0.65
58 0.57
59 0.47
60 0.37
61 0.28
62 0.26
63 0.21
64 0.23
65 0.22
66 0.23
67 0.24
68 0.24
69 0.23
70 0.21
71 0.25
72 0.26
73 0.3
74 0.37
75 0.43
76 0.46
77 0.49
78 0.5
79 0.45
80 0.51
81 0.53
82 0.51
83 0.46
84 0.48
85 0.49
86 0.48
87 0.46
88 0.38
89 0.31
90 0.26
91 0.26
92 0.23
93 0.18
94 0.18
95 0.16
96 0.14
97 0.14
98 0.16
99 0.14
100 0.12
101 0.13
102 0.18
103 0.21
104 0.21
105 0.24
106 0.23
107 0.28
108 0.3
109 0.3
110 0.24
111 0.22
112 0.23
113 0.26
114 0.28
115 0.25
116 0.22
117 0.22
118 0.22
119 0.22
120 0.23
121 0.18
122 0.15
123 0.15
124 0.15
125 0.14
126 0.15
127 0.14
128 0.12
129 0.11
130 0.08
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.1
141 0.1
142 0.12
143 0.15
144 0.16
145 0.18
146 0.18
147 0.19
148 0.17
149 0.19
150 0.21
151 0.18
152 0.18
153 0.17
154 0.18
155 0.18
156 0.17
157 0.14
158 0.12
159 0.13
160 0.14
161 0.14
162 0.14
163 0.13
164 0.14
165 0.14
166 0.13
167 0.13
168 0.14
169 0.15
170 0.16
171 0.17
172 0.18
173 0.17
174 0.17
175 0.16
176 0.18
177 0.17
178 0.17
179 0.17
180 0.2
181 0.2
182 0.22
183 0.22
184 0.2
185 0.23
186 0.23
187 0.22
188 0.19
189 0.19
190 0.17
191 0.17
192 0.15
193 0.09
194 0.08
195 0.07
196 0.06
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.06
205 0.06
206 0.07
207 0.08
208 0.09
209 0.1
210 0.11
211 0.12
212 0.14
213 0.18
214 0.2
215 0.22
216 0.22
217 0.23
218 0.24
219 0.25
220 0.29
221 0.33
222 0.39