Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2GX75

Protein Details
Accession I2GX75    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-41TTNKKIKQTSRLRHNHHTLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG tbl:TBLA_0A09420  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
Amino Acid Sequences MSLQLPEFLLKDTSSEINSTDTTNKKIKQTSRLRHNHHTLHCAYNGCNNVAKKLIGECQLCNGIYCSKHRILETHDCSGLRDCKMELRERNMKKLINERTISEKIRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.16
5 0.17
6 0.18
7 0.21
8 0.22
9 0.26
10 0.32
11 0.34
12 0.37
13 0.44
14 0.47
15 0.52
16 0.6
17 0.65
18 0.69
19 0.75
20 0.77
21 0.79
22 0.81
23 0.78
24 0.7
25 0.66
26 0.58
27 0.51
28 0.46
29 0.39
30 0.32
31 0.29
32 0.27
33 0.22
34 0.23
35 0.2
36 0.19
37 0.19
38 0.19
39 0.14
40 0.14
41 0.15
42 0.17
43 0.18
44 0.16
45 0.17
46 0.19
47 0.18
48 0.17
49 0.16
50 0.13
51 0.14
52 0.16
53 0.2
54 0.21
55 0.23
56 0.23
57 0.24
58 0.28
59 0.37
60 0.4
61 0.38
62 0.37
63 0.35
64 0.36
65 0.39
66 0.36
67 0.27
68 0.24
69 0.21
70 0.24
71 0.29
72 0.36
73 0.37
74 0.41
75 0.5
76 0.53
77 0.6
78 0.6
79 0.6
80 0.58
81 0.62
82 0.63
83 0.61
84 0.59
85 0.54
86 0.56
87 0.59