Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DM94

Protein Details
Accession A0A178DM94    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-71HEWIRDRKGRPQKRRLTPAQRQAKQRBasic
NLS Segment(s)
PositionSequence
52-60RKGRPQKRR
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MLSPRFSISSITSRLSGEKPMPKPHYFCKMNPEEQDLWAIIGEQTHEWIRDRKGRPQKRRLTPAQRQAKQRMFYDTRVGHAIVGDEWMRMKLPTRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.27
4 0.28
5 0.33
6 0.36
7 0.45
8 0.5
9 0.51
10 0.54
11 0.56
12 0.6
13 0.55
14 0.52
15 0.52
16 0.53
17 0.55
18 0.52
19 0.52
20 0.43
21 0.39
22 0.39
23 0.29
24 0.22
25 0.16
26 0.14
27 0.08
28 0.06
29 0.06
30 0.05
31 0.06
32 0.07
33 0.07
34 0.09
35 0.11
36 0.15
37 0.23
38 0.26
39 0.34
40 0.44
41 0.54
42 0.63
43 0.7
44 0.77
45 0.78
46 0.84
47 0.85
48 0.85
49 0.84
50 0.84
51 0.84
52 0.8
53 0.78
54 0.79
55 0.76
56 0.7
57 0.63
58 0.61
59 0.55
60 0.51
61 0.53
62 0.44
63 0.4
64 0.38
65 0.36
66 0.27
67 0.23
68 0.21
69 0.12
70 0.14
71 0.12
72 0.1
73 0.11
74 0.11
75 0.12
76 0.11
77 0.14