Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DV13

Protein Details
Accession A0A178DV13    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
280-299LEEMSSRERRVKSRKSGKRQBasic
NLS Segment(s)
PositionSequence
286-299RERRVKSRKSGKRQ
Subcellular Location(s) mito 12.5mito_nucl 12.5, nucl 11.5
Family & Domain DBs
Amino Acid Sequences MAQLGVNSPKSALHKSITNFDPLQTGPKQCNNTISLFSLPYDIRELIFRFYLEDYTPWGVHYMRVQSAHYHYYHQRIKFERRLSSLYLVSKQVYDEAHAAFCRYTRVTFGPYGREKYLQGTLRLFPYQTAQMLQRVYMSYSWRTPDFRKRAHFRDPSMPKVWRQMLEDAYTLERFLPQLREFTAHWRESLHWFRAHGLELQDSGMCYLLMTEEETIQVWLKWMREMLGTVCFAPPRWLVLEGDKSAAKMAMGKAYQRLVEGHTTVQCSEVELEDSGRKWLEEMSSRERRVKSRKSGKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.43
4 0.41
5 0.42
6 0.38
7 0.35
8 0.35
9 0.3
10 0.33
11 0.29
12 0.32
13 0.31
14 0.38
15 0.42
16 0.41
17 0.46
18 0.43
19 0.41
20 0.4
21 0.37
22 0.31
23 0.28
24 0.26
25 0.24
26 0.21
27 0.19
28 0.2
29 0.18
30 0.16
31 0.19
32 0.2
33 0.19
34 0.2
35 0.18
36 0.16
37 0.17
38 0.18
39 0.16
40 0.15
41 0.16
42 0.19
43 0.19
44 0.17
45 0.18
46 0.16
47 0.17
48 0.2
49 0.2
50 0.2
51 0.22
52 0.22
53 0.24
54 0.28
55 0.31
56 0.28
57 0.29
58 0.29
59 0.37
60 0.42
61 0.42
62 0.45
63 0.47
64 0.55
65 0.59
66 0.62
67 0.58
68 0.56
69 0.57
70 0.53
71 0.5
72 0.46
73 0.4
74 0.36
75 0.32
76 0.28
77 0.25
78 0.22
79 0.2
80 0.16
81 0.14
82 0.14
83 0.13
84 0.14
85 0.13
86 0.14
87 0.11
88 0.11
89 0.12
90 0.12
91 0.11
92 0.13
93 0.15
94 0.18
95 0.21
96 0.23
97 0.28
98 0.3
99 0.34
100 0.32
101 0.32
102 0.29
103 0.28
104 0.33
105 0.28
106 0.27
107 0.26
108 0.26
109 0.27
110 0.27
111 0.24
112 0.17
113 0.16
114 0.15
115 0.13
116 0.13
117 0.12
118 0.14
119 0.14
120 0.14
121 0.13
122 0.12
123 0.12
124 0.12
125 0.14
126 0.13
127 0.14
128 0.16
129 0.17
130 0.19
131 0.23
132 0.31
133 0.35
134 0.39
135 0.46
136 0.51
137 0.55
138 0.62
139 0.62
140 0.56
141 0.59
142 0.58
143 0.55
144 0.54
145 0.51
146 0.42
147 0.44
148 0.43
149 0.35
150 0.33
151 0.31
152 0.28
153 0.27
154 0.26
155 0.2
156 0.19
157 0.17
158 0.14
159 0.11
160 0.09
161 0.08
162 0.09
163 0.12
164 0.12
165 0.13
166 0.14
167 0.17
168 0.17
169 0.24
170 0.3
171 0.26
172 0.25
173 0.25
174 0.26
175 0.31
176 0.36
177 0.32
178 0.27
179 0.27
180 0.29
181 0.29
182 0.28
183 0.24
184 0.19
185 0.16
186 0.15
187 0.15
188 0.13
189 0.12
190 0.1
191 0.08
192 0.06
193 0.05
194 0.05
195 0.04
196 0.04
197 0.05
198 0.06
199 0.05
200 0.06
201 0.07
202 0.07
203 0.08
204 0.07
205 0.08
206 0.1
207 0.11
208 0.12
209 0.12
210 0.12
211 0.13
212 0.14
213 0.14
214 0.15
215 0.15
216 0.15
217 0.15
218 0.15
219 0.14
220 0.17
221 0.15
222 0.14
223 0.16
224 0.17
225 0.17
226 0.22
227 0.28
228 0.25
229 0.27
230 0.25
231 0.23
232 0.22
233 0.21
234 0.15
235 0.13
236 0.13
237 0.17
238 0.18
239 0.2
240 0.23
241 0.25
242 0.25
243 0.23
244 0.23
245 0.19
246 0.23
247 0.22
248 0.22
249 0.23
250 0.25
251 0.23
252 0.24
253 0.2
254 0.18
255 0.18
256 0.15
257 0.14
258 0.13
259 0.15
260 0.17
261 0.18
262 0.18
263 0.18
264 0.16
265 0.15
266 0.17
267 0.2
268 0.25
269 0.31
270 0.38
271 0.47
272 0.51
273 0.58
274 0.6
275 0.64
276 0.67
277 0.71
278 0.72
279 0.74