Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A178DEU3

Protein Details
Accession A0A178DEU3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-108RETVLKKVRRLKKEMRRLELBasic
NLS Segment(s)
PositionSequence
97-101RRLKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEPNQYETMASPQKSTCSESTEVDDTFTQDVLQTRPSVPNEDTFFSERARSSSGEGIHTAAKNRGSNSKYCAHSSLLSRPNSAYALISRETVLKKVRRLKKEMRRLELLVWRADKDGGCQARISITVRKHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.29
4 0.28
5 0.3
6 0.29
7 0.33
8 0.33
9 0.3
10 0.27
11 0.26
12 0.22
13 0.2
14 0.18
15 0.12
16 0.11
17 0.13
18 0.12
19 0.14
20 0.13
21 0.14
22 0.19
23 0.21
24 0.23
25 0.23
26 0.27
27 0.28
28 0.28
29 0.29
30 0.27
31 0.27
32 0.23
33 0.24
34 0.19
35 0.18
36 0.18
37 0.16
38 0.16
39 0.18
40 0.18
41 0.17
42 0.17
43 0.17
44 0.17
45 0.17
46 0.16
47 0.14
48 0.16
49 0.16
50 0.17
51 0.23
52 0.22
53 0.23
54 0.26
55 0.3
56 0.3
57 0.3
58 0.31
59 0.26
60 0.27
61 0.28
62 0.32
63 0.32
64 0.31
65 0.3
66 0.28
67 0.28
68 0.26
69 0.24
70 0.16
71 0.1
72 0.12
73 0.12
74 0.13
75 0.12
76 0.15
77 0.15
78 0.18
79 0.24
80 0.26
81 0.33
82 0.43
83 0.51
84 0.55
85 0.63
86 0.7
87 0.73
88 0.79
89 0.81
90 0.78
91 0.75
92 0.7
93 0.68
94 0.64
95 0.57
96 0.51
97 0.44
98 0.38
99 0.33
100 0.33
101 0.27
102 0.24
103 0.3
104 0.27
105 0.26
106 0.25
107 0.24
108 0.24
109 0.27
110 0.27
111 0.25