Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178EBL6

Protein Details
Accession A0A178EBL6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20PSTHPFPSKKCPPNPFQPTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, extr 11, cyto_mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018620  Ubiquitin3-bd_protein_But2_C  
Pfam View protein in Pfam  
PF09792  But2  
Amino Acid Sequences PSTHPFPSKKCPPNPFQPTGHLPPGSISTSLLVPISASHPTKAYPASDWATVTPNDTCTIFNLELDSAAVQGKICSLVFDFPATPGLVAFSGPGTFTFTGYDINAGAVAGVTTYNNQPRAGPSPPFPPPRMVPGNSYVVNSAPCGIPPGIGKVTVSGALCSVDTVLRFRQSDLGCPLGFFVVLSEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.71
4 0.68
5 0.67
6 0.65
7 0.64
8 0.53
9 0.44
10 0.39
11 0.38
12 0.33
13 0.26
14 0.2
15 0.14
16 0.14
17 0.15
18 0.13
19 0.09
20 0.07
21 0.08
22 0.09
23 0.13
24 0.14
25 0.14
26 0.15
27 0.16
28 0.18
29 0.19
30 0.19
31 0.15
32 0.19
33 0.21
34 0.22
35 0.22
36 0.2
37 0.21
38 0.2
39 0.2
40 0.16
41 0.14
42 0.14
43 0.14
44 0.13
45 0.12
46 0.17
47 0.15
48 0.14
49 0.14
50 0.13
51 0.12
52 0.12
53 0.1
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.05
62 0.05
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.07
69 0.09
70 0.08
71 0.08
72 0.06
73 0.07
74 0.06
75 0.05
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.06
90 0.06
91 0.05
92 0.05
93 0.04
94 0.03
95 0.03
96 0.02
97 0.02
98 0.03
99 0.04
100 0.07
101 0.1
102 0.12
103 0.12
104 0.13
105 0.16
106 0.2
107 0.22
108 0.22
109 0.22
110 0.26
111 0.33
112 0.38
113 0.36
114 0.36
115 0.34
116 0.39
117 0.42
118 0.38
119 0.34
120 0.33
121 0.37
122 0.34
123 0.33
124 0.26
125 0.21
126 0.2
127 0.17
128 0.15
129 0.1
130 0.09
131 0.11
132 0.11
133 0.11
134 0.12
135 0.16
136 0.16
137 0.16
138 0.16
139 0.14
140 0.15
141 0.16
142 0.16
143 0.11
144 0.11
145 0.11
146 0.11
147 0.1
148 0.1
149 0.08
150 0.09
151 0.12
152 0.14
153 0.19
154 0.2
155 0.21
156 0.28
157 0.28
158 0.34
159 0.35
160 0.37
161 0.31
162 0.31
163 0.3
164 0.23
165 0.22
166 0.15
167 0.11