Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2H548

Protein Details
Accession I2H548    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-94YQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSHHydrophilic
NLS Segment(s)
PositionSequence
61-89KRKRKHGFLSRAKSYTMNKILKRRKAKGR
Subcellular Location(s) mito 19, mito_nucl 12.833, cyto_mito 10.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tbl:TBLA_0E04470  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MGIFNSLTRIACFSKSTALNSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.27
4 0.29
5 0.28
6 0.26
7 0.26
8 0.28
9 0.24
10 0.22
11 0.21
12 0.16
13 0.16
14 0.16
15 0.19
16 0.18
17 0.18
18 0.18
19 0.17
20 0.2
21 0.19
22 0.2
23 0.17
24 0.14
25 0.12
26 0.11
27 0.11
28 0.09
29 0.1
30 0.14
31 0.21
32 0.24
33 0.3
34 0.32
35 0.35
36 0.38
37 0.48
38 0.52
39 0.53
40 0.57
41 0.54
42 0.61
43 0.61
44 0.62
45 0.6
46 0.59
47 0.61
48 0.59
49 0.67
50 0.65
51 0.71
52 0.76
53 0.77
54 0.8
55 0.8
56 0.83
57 0.79
58 0.75
59 0.67
60 0.61
61 0.54
62 0.53
63 0.52
64 0.51
65 0.5
66 0.59
67 0.67
68 0.72
69 0.79
70 0.79
71 0.8
72 0.83
73 0.87
74 0.87