Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E120

Protein Details
Accession A0A178E120   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
305-330VKQALCSPSKSPRRKSKKSSDEVDDAHydrophilic
NLS Segment(s)
PositionSequence
256-269KKKTSRGKAEKKAK
316-321PRRKSK
Subcellular Location(s) mito 22.5, cyto_mito 12.833, cyto_nucl 2.333, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039197  Mrs1/Cce1  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
IPR003034  SAP_dom  
IPR015242  Ydc2_cat  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF09159  Ydc2-catalyt  
PROSITE View protein in PROSITE  
PS50800  SAP  
CDD cd16963  CCE1  
Amino Acid Sequences MAPKKQTVTAKALQSLLTRIGSASSGTKATLQDRLVRDIYKSRLFERRVDWKARQELDWGRKLRIVSIDMGIKNLAFCDVEVDYPSKDSLNATMNVIRWEKIDLVKSTRSFRHHLPSPKKIKKGSIDEDEDVDPYSLKVLSRTAHSLIKRDILAGAPDIILIEKQRWRSGGGSAILQWTVRVNTLEAMLWAILQTLRSEWEIALEGYRKPGKRDYDVCEVDPKRVGQYWLGQTNQAQELSLSDEEGVDEKDEAATKKKTSRGKAEKKAKVAILRSWLSPDVPSTVPSAKGNTPTISFDIIRAGHVKQALCSPSKSPRRKSKKSSDEVDDAGADLKKLDDMTDCFLQAAAWVSWESNRLQLLAVQDKKRKEDGSVAKMSDEVVLEMAKEVGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.34
4 0.28
5 0.22
6 0.19
7 0.18
8 0.16
9 0.16
10 0.15
11 0.14
12 0.14
13 0.14
14 0.17
15 0.19
16 0.21
17 0.26
18 0.26
19 0.31
20 0.33
21 0.39
22 0.39
23 0.37
24 0.38
25 0.39
26 0.43
27 0.43
28 0.43
29 0.42
30 0.48
31 0.5
32 0.53
33 0.53
34 0.57
35 0.57
36 0.62
37 0.63
38 0.63
39 0.69
40 0.66
41 0.59
42 0.56
43 0.58
44 0.59
45 0.61
46 0.55
47 0.48
48 0.48
49 0.47
50 0.43
51 0.39
52 0.32
53 0.26
54 0.27
55 0.32
56 0.29
57 0.29
58 0.26
59 0.21
60 0.18
61 0.16
62 0.13
63 0.07
64 0.07
65 0.09
66 0.09
67 0.1
68 0.12
69 0.13
70 0.12
71 0.13
72 0.14
73 0.11
74 0.11
75 0.11
76 0.13
77 0.16
78 0.17
79 0.18
80 0.21
81 0.22
82 0.25
83 0.26
84 0.22
85 0.18
86 0.19
87 0.19
88 0.2
89 0.24
90 0.23
91 0.26
92 0.32
93 0.34
94 0.38
95 0.41
96 0.42
97 0.4
98 0.42
99 0.46
100 0.49
101 0.56
102 0.6
103 0.65
104 0.71
105 0.75
106 0.78
107 0.73
108 0.72
109 0.7
110 0.7
111 0.67
112 0.64
113 0.61
114 0.55
115 0.53
116 0.46
117 0.38
118 0.3
119 0.22
120 0.15
121 0.09
122 0.09
123 0.07
124 0.07
125 0.07
126 0.09
127 0.1
128 0.13
129 0.16
130 0.17
131 0.22
132 0.23
133 0.26
134 0.26
135 0.28
136 0.25
137 0.23
138 0.2
139 0.16
140 0.15
141 0.12
142 0.11
143 0.07
144 0.07
145 0.07
146 0.06
147 0.06
148 0.05
149 0.08
150 0.1
151 0.12
152 0.14
153 0.15
154 0.17
155 0.18
156 0.19
157 0.21
158 0.19
159 0.17
160 0.17
161 0.17
162 0.15
163 0.13
164 0.12
165 0.08
166 0.07
167 0.07
168 0.07
169 0.07
170 0.07
171 0.08
172 0.08
173 0.07
174 0.06
175 0.05
176 0.05
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.04
183 0.05
184 0.06
185 0.06
186 0.06
187 0.07
188 0.07
189 0.07
190 0.08
191 0.09
192 0.08
193 0.12
194 0.16
195 0.16
196 0.18
197 0.24
198 0.26
199 0.31
200 0.37
201 0.39
202 0.44
203 0.45
204 0.44
205 0.47
206 0.43
207 0.39
208 0.35
209 0.3
210 0.22
211 0.22
212 0.22
213 0.15
214 0.21
215 0.24
216 0.26
217 0.26
218 0.25
219 0.24
220 0.26
221 0.26
222 0.2
223 0.15
224 0.1
225 0.1
226 0.13
227 0.12
228 0.09
229 0.08
230 0.08
231 0.08
232 0.09
233 0.08
234 0.05
235 0.06
236 0.05
237 0.06
238 0.08
239 0.09
240 0.13
241 0.16
242 0.18
243 0.24
244 0.3
245 0.37
246 0.42
247 0.52
248 0.58
249 0.66
250 0.74
251 0.79
252 0.79
253 0.77
254 0.76
255 0.68
256 0.63
257 0.56
258 0.49
259 0.46
260 0.41
261 0.36
262 0.34
263 0.31
264 0.25
265 0.22
266 0.2
267 0.16
268 0.15
269 0.15
270 0.16
271 0.17
272 0.18
273 0.19
274 0.22
275 0.2
276 0.24
277 0.26
278 0.24
279 0.24
280 0.25
281 0.25
282 0.25
283 0.23
284 0.19
285 0.2
286 0.19
287 0.18
288 0.18
289 0.17
290 0.16
291 0.19
292 0.19
293 0.16
294 0.22
295 0.24
296 0.24
297 0.25
298 0.27
299 0.34
300 0.44
301 0.52
302 0.57
303 0.64
304 0.73
305 0.81
306 0.87
307 0.88
308 0.89
309 0.88
310 0.86
311 0.82
312 0.77
313 0.68
314 0.6
315 0.48
316 0.38
317 0.32
318 0.24
319 0.17
320 0.12
321 0.1
322 0.1
323 0.1
324 0.1
325 0.11
326 0.13
327 0.18
328 0.2
329 0.2
330 0.19
331 0.19
332 0.18
333 0.15
334 0.17
335 0.11
336 0.1
337 0.11
338 0.11
339 0.13
340 0.15
341 0.15
342 0.15
343 0.16
344 0.15
345 0.15
346 0.17
347 0.23
348 0.3
349 0.37
350 0.41
351 0.47
352 0.51
353 0.56
354 0.6
355 0.55
356 0.49
357 0.52
358 0.54
359 0.57
360 0.59
361 0.55
362 0.49
363 0.47
364 0.44
365 0.36
366 0.26
367 0.18
368 0.12
369 0.11
370 0.1
371 0.11
372 0.1