Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178E3D5

Protein Details
Accession A0A178E3D5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
61-87DSTLKPPGKPPGKRKRWKFYRGSKSTWHydrophilic
97-118APNTTCSKKAERYSRRDPSRSRHydrophilic
NLS Segment(s)
PositionSequence
65-79KPPGKPPGKRKRWKF
Subcellular Location(s) extr 14, plas 7, mito 4
Family & Domain DBs
Amino Acid Sequences MLLSCIGLLQGPVSALVLLPAIAANLSPGREFRFPSTLSTLDIVGPASPVYTLSIQIAREDSTLKPPGKPPGKRKRWKFYRGSKSTWVWTGRLPFPAPNTTCSKKAERYSRRDPSRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.06
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.06
13 0.07
14 0.07
15 0.08
16 0.13
17 0.15
18 0.17
19 0.19
20 0.23
21 0.23
22 0.26
23 0.29
24 0.26
25 0.25
26 0.24
27 0.21
28 0.16
29 0.16
30 0.12
31 0.08
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.06
38 0.06
39 0.06
40 0.07
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.09
47 0.1
48 0.1
49 0.13
50 0.19
51 0.19
52 0.2
53 0.22
54 0.31
55 0.38
56 0.45
57 0.51
58 0.57
59 0.67
60 0.75
61 0.82
62 0.84
63 0.85
64 0.87
65 0.87
66 0.86
67 0.87
68 0.83
69 0.8
70 0.75
71 0.69
72 0.63
73 0.59
74 0.51
75 0.41
76 0.39
77 0.39
78 0.34
79 0.35
80 0.32
81 0.29
82 0.31
83 0.38
84 0.35
85 0.34
86 0.39
87 0.39
88 0.42
89 0.44
90 0.47
91 0.46
92 0.54
93 0.61
94 0.63
95 0.68
96 0.75
97 0.81
98 0.84