Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A178DWV4

Protein Details
Accession A0A178DWV4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-74PVFARRSAKGRCHRRNWFAVEAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 6
Family & Domain DBs
Amino Acid Sequences MKDVIGLLTALCNVASKPHVKLSNHLAIFYTLGVYRDREFDISGLGGGYNLFPVFARRSAKGRCHRRNWFAVEATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.13
4 0.15
5 0.22
6 0.29
7 0.29
8 0.34
9 0.38
10 0.44
11 0.42
12 0.39
13 0.33
14 0.27
15 0.26
16 0.22
17 0.16
18 0.07
19 0.08
20 0.09
21 0.09
22 0.09
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.1
29 0.08
30 0.08
31 0.06
32 0.05
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.07
41 0.09
42 0.14
43 0.17
44 0.19
45 0.26
46 0.33
47 0.43
48 0.51
49 0.6
50 0.65
51 0.72
52 0.8
53 0.82
54 0.84
55 0.81
56 0.77